BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0181.Seq (897 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 31 1.6 08_02_0632 + 19515234-19515374,19515489-19515656,19518907-195189... 29 6.6 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 785 LHRGSQSCHWWSTYXIGKIGTRXRFEHRCIAP 690 L G + C ++S Y I K G +F+H +AP Sbjct: 377 LRPGEELCKFYSRYGICKFGANCKFDHPTMAP 408 >08_02_0632 + 19515234-19515374,19515489-19515656,19518907-19518993, 19519551-19519685,19519778-19519882,19519968-19520059, 19520147-19520252,19520320-19520424,19520516-19520929 Length = 450 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 547 IHTSLNYNLIFENTQHDIFNIAIEMVTRWET 455 +H L NL++ T+HD++ + + VT W + Sbjct: 129 VHFQLR-NLVWATTKHDVYTVHNQSVTHWSS 158 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,042,011 Number of Sequences: 37544 Number of extensions: 372791 Number of successful extensions: 622 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -