BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0181.Seq (897 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27646| Best HMM Match : CbiK (HMM E-Value=2.2) 32 0.72 SB_23952| Best HMM Match : THUMP (HMM E-Value=2.4e-09) 29 6.7 >SB_27646| Best HMM Match : CbiK (HMM E-Value=2.2) Length = 423 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 777 WKSIVPLVEYVXHWKNWYPXEIRTPVHRSN 688 WK+I VEY+ + K WYP ++ + R++ Sbjct: 347 WKTINSAVEYISNEKGWYPYDVSMNIIRNS 376 >SB_23952| Best HMM Match : THUMP (HMM E-Value=2.4e-09) Length = 229 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +2 Query: 440 QLCFFCLP---TCYHFNRDIKNIVLSIFEDKIIIK 535 +LC LP TC+ DIK LS+FED +++ Sbjct: 139 RLCLRFLPVDATCHAKEEDIKKTALSLFEDYFLVE 173 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,354,497 Number of Sequences: 59808 Number of extensions: 471288 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2574115416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -