BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0181.Seq (897 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04920.1 68417.m00715 expressed protein 29 3.2 At4g25870.1 68417.m03720 expressed protein contains Pfam profile... 28 9.7 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -1 Query: 804 IPGCYXPSPWKSIVPLVEYVXHWKNWYPXEIRTPVHRSNTNVPDVLSL 661 +P S W PL Y+ W+ + EI+ S+ + D +SL Sbjct: 369 VPPSLSSSSWTGFAPLAAYLFSWQEYLISEIKQGKKPSDQDSSDAISL 416 >At4g25870.1 68417.m03720 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 389 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 370 IFLKAILFNIL*WTSDFFSSNNLTAMFFLSPNVLPFQ 480 I +A++ +IL T F ++N+ A FL+P LPF+ Sbjct: 78 IAARAVVRDIL-RTPPFITNNSKIAFLFLTPGTLPFE 113 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,127,720 Number of Sequences: 28952 Number of extensions: 334351 Number of successful extensions: 627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2110422216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -