BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0180.Seq (986 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1215 + 9815918-9816218,9816772-9816912,9816988-9817106,981... 29 5.7 >01_01_1215 + 9815918-9816218,9816772-9816912,9816988-9817106, 9817922-9818191,9818330-9818369,9818519-9818616, 9818745-9818825 Length = 349 Score = 29.1 bits (62), Expect = 5.7 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = +3 Query: 180 SRARFQLSGNSGRKHSRCCTS-ILRKLVAGSIVSQLTAAAMVAPTP*GD 323 S++ LS +GRK R C+ ++R + SI + LT+AA+V P P GD Sbjct: 137 SQSIVSLSSFAGRKRIRVCSGFVIRWNDSTSIGTILTSAALVRP-PCGD 184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,994,774 Number of Sequences: 37544 Number of extensions: 496077 Number of successful extensions: 866 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 852 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2881826040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -