BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0180.Seq (986 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 8e-12 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 66 3e-11 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 64 2e-10 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 64 2e-10 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 59 6e-09 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 56 3e-08 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 53 4e-07 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 52 7e-07 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 52 1e-06 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-06 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 51 2e-06 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 50 2e-06 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 50 2e-06 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 50 3e-06 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 50 3e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 50 4e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 50 4e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 50 4e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 50 4e-06 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 50 4e-06 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 50 4e-06 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 50 4e-06 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 50 4e-06 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 50 4e-06 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 50 4e-06 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 50 4e-06 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 50 4e-06 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 50 4e-06 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 50 4e-06 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 50 4e-06 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 50 4e-06 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 50 4e-06 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 50 4e-06 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 50 4e-06 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 50 4e-06 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 50 4e-06 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 50 4e-06 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 50 4e-06 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 50 4e-06 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 50 4e-06 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 50 4e-06 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 50 4e-06 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 50 4e-06 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 50 4e-06 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 50 4e-06 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 50 4e-06 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 50 4e-06 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 50 4e-06 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 50 4e-06 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 50 4e-06 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 50 4e-06 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 50 4e-06 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 50 4e-06 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 50 4e-06 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 50 4e-06 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 50 4e-06 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 50 4e-06 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 50 4e-06 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 50 4e-06 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 50 4e-06 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 50 4e-06 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 50 4e-06 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 48 9e-06 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 48 9e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 48 9e-06 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 48 9e-06 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 48 9e-06 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 48 9e-06 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42480| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 48 9e-06 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 48 9e-06 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 48 9e-06 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 48 1e-05 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 48 1e-05 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 48 1e-05 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 48 1e-05 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 48 1e-05 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 48 2e-05 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_44498| Best HMM Match : BA14K (HMM E-Value=7) 48 2e-05 SB_19991| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 47 2e-05 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 47 2e-05 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 47 2e-05 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 47 2e-05 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 47 2e-05 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 47 2e-05 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 47 2e-05 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 47 2e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 47 2e-05 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 47 2e-05 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 47 2e-05 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 47 2e-05 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 47 2e-05 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 47 2e-05 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 47 2e-05 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 47 2e-05 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 47 2e-05 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 47 2e-05 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 47 2e-05 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 47 2e-05 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 47 2e-05 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 47 2e-05 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 47 2e-05 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 47 2e-05 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 47 2e-05 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 47 2e-05 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 47 2e-05 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 47 2e-05 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 47 2e-05 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 47 2e-05 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 47 2e-05 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 47 2e-05 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 47 2e-05 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 47 2e-05 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 47 2e-05 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 47 2e-05 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 47 2e-05 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58324| Best HMM Match : Keratin_B2 (HMM E-Value=0.47) 47 2e-05 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 47 2e-05 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 47 2e-05 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 47 2e-05 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 47 2e-05 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 47 2e-05 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 47 2e-05 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 47 2e-05 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 47 2e-05 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 47 2e-05 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 47 2e-05 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) 47 2e-05 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 47 2e-05 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 47 2e-05 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 47 2e-05 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 47 2e-05 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 47 2e-05 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 79.4 bits (187), Expect = 4e-15 Identities = 40/64 (62%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +1 Query: 472 IRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXX 648 IRPIVSRITIHW SFYKRRDW NPGV QLNRL H PF+ + ++ A RPS QLR Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFA-SWRSSEEARTDRPSQQLRRL 76 Query: 649 XANW 660 W Sbjct: 77 NGEW 80 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 73.7 bits (173), Expect = 2e-13 Identities = 36/65 (55%), Positives = 40/65 (61%) Frame = -3 Query: 663 LPIRXXXAQLXGRANRFGXLXYYPSWRKGDVLQAIKLGNARVXPVTTFVKRRPVNCNTTH 484 +P AQL GRA G P+ +G +AIKLGNA V P VKRRPVNCNTTH Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTH 62 Query: 483 YRANW 469 YRANW Sbjct: 63 YRANW 67 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 69.3 bits (162), Expect = 4e-12 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = -3 Query: 642 AQLXGRANRFGXLXYYPSWRKGDVLQA-IKLGNARVXPVTTFVKRRPVNCNTTHYRANW 469 AQL GRA G P+ KGDVLQ +KLG + P VKRRPVNCNTTHYRANW Sbjct: 44 AQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 68.5 bits (160), Expect = 8e-12 Identities = 33/63 (52%), Positives = 37/63 (58%) Frame = +1 Query: 472 IRPIVSRITIHWASFYKRRDWXNPGVTQLNRLQHIPFSPAGVITKXAEPIRPSXQLRXXX 651 +RP+VSRITIHW SFY + L LQHIP SPAGVI + A RPS QLR Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 652 ANW 660 W Sbjct: 93 GEW 95 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 67.3 bits (157), Expect = 2e-11 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -3 Query: 630 GRANRFGXLXYYPSWRKGDVLQAIKLGNARVXPVTTFVKRRPVNCNTTHYRANW 469 G+ +R G P+ +G +AIKLGNA+ P VKRRPVNCNTTHYRANW Sbjct: 6 GKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 35.5 bits (78), Expect = 0.067 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -2 Query: 643 CATVGKGESVRPSXLLPQLAKRGCAASD*VG*RQGXPSHDVCKTTP 506 CATVGKG+ + P + C + +G +G PSHDV K P Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRP 47 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 66.5 bits (155), Expect = 3e-11 Identities = 32/58 (55%), Positives = 37/58 (63%) Frame = -3 Query: 642 AQLXGRANRFGXLXYYPSWRKGDVLQAIKLGNARVXPVTTFVKRRPVNCNTTHYRANW 469 AQL GRA G P+ +G ++IKL +A V P VKRRPVNCNTTHYRANW Sbjct: 4 AQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 64.1 bits (149), Expect = 2e-10 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 484 VSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 +SRITIHW S +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEW 335 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 64.1 bits (149), Expect = 2e-10 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -3 Query: 612 GXLXYYPSWRKGDVLQAIKLGNARVXPVTTFVKRRPVNCNTTHYRANW 469 G P+ +G +AIKLGNA V P VKRRPVNCNTTHYRANW Sbjct: 6 GLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 620 IGSAXXVITPAGEKGMCCKRL 558 IG+ ITPAGE+GMCCK + Sbjct: 3 IGAGLFAITPAGERGMCCKAI 23 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 63.7 bits (148), Expect = 2e-10 Identities = 33/61 (54%), Positives = 37/61 (60%) Frame = -3 Query: 654 RXXXAQLXGRANRFGXLXYYPSWRKGDVLQAIKLGNARVXPVTTFVKRRPVNCNTTHYRA 475 R AQL GR+ G P+ +G +AIKLGNAR P KRRPVNCNTTHYRA Sbjct: 37 RYRVAQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRA 96 Query: 474 N 472 N Sbjct: 97 N 97 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 61.7 bits (143), Expect = 9e-10 Identities = 33/65 (50%), Positives = 37/65 (56%) Frame = -3 Query: 663 LPIRXXXAQLXGRANRFGXLXYYPSWRKGDVLQAIKLGNARVXPVTTFVKRRPVNCNTTH 484 +P AQL GRA G P+ +G +AIKL V P VKRRPVNCNTTH Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTP-VFPSHDVVKRRPVNCNTTH 1894 Query: 483 YRANW 469 YRANW Sbjct: 1895 YRANW 1899 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 60.1 bits (139), Expect = 3e-09 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +1 Query: 487 SRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 SRITIHW SFY W NPGVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEW 59 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 58.8 bits (136), Expect = 6e-09 Identities = 36/72 (50%), Positives = 41/72 (56%), Gaps = 1/72 (1%) Frame = +1 Query: 448 TRGGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIR 624 T GGA PIRPIVSRITIHW +FY TQLNRL H PF+ + ++ A R Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFA-SWRNSQEARADR 90 Query: 625 PSXQLRXXXANW 660 PS QLR W Sbjct: 91 PSQQLRSLNGEW 102 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/61 (47%), Positives = 33/61 (54%) Frame = +1 Query: 478 PIVSRITIHWASFYKRRDWXNPGVTQLNRLQHIPFSPAGVITKXAEPIRPSXQLRXXXAN 657 P +SRITIHW SFY + L LQHIP SPAG+ + A RPS QLR Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 658 W 660 W Sbjct: 137 W 137 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 57.2 bits (132), Expect = 2e-08 Identities = 29/58 (50%), Positives = 32/58 (55%) Frame = +1 Query: 487 SRITIHWASFYKRRDWXNPGVTQLNRLQHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 SRITIHW SFY + L LQHIP SPAGV ++ A RPS QLR W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/58 (50%), Positives = 30/58 (51%) Frame = +1 Query: 487 SRITIHWASFYKRRDWXNPGVTQLNRLQHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 SRITIHW SFY + L LQHIP SPAGVI K PI QLR W Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/59 (52%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 487 SRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 SRITIHW SFY NPGVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEW 59 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 54.0 bits (124), Expect = 2e-07 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +1 Query: 451 RGGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRP 627 RGG P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RP Sbjct: 43 RGGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP 101 Query: 628 SXQLRXXXANWQIV 669 S QLR W+++ Sbjct: 102 SQQLRSLNGEWRLM 115 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -3 Query: 582 KGDVLQAIKLGNARVXPVTTFVKRRPVNCNTTHYRAN 472 +G +AIKLGNA V VKRRPVNCNTTHYRAN Sbjct: 4 RGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 52.8 bits (121), Expect = 4e-07 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +1 Query: 451 RGGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRP 627 +GG P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RP Sbjct: 51 QGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP 109 Query: 628 SXQLRXXXANWQIV 669 S QLR W+++ Sbjct: 110 SQQLRSLNGEWRLM 123 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 52.0 bits (119), Expect = 7e-07 Identities = 29/73 (39%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +1 Query: 454 GGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPS 630 G +YP ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS Sbjct: 17 GYIKYPPESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPS 75 Query: 631 XQLRXXXANWQIV 669 QLR W+++ Sbjct: 76 QQLRSLNGEWRLM 88 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 51.6 bits (118), Expect = 1e-06 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 517 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 575 Query: 646 XXANWQIVSAK 678 W+++ A+ Sbjct: 576 LNGEWRLMRAR 586 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.6 bits (118), Expect = 1e-06 Identities = 30/59 (50%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 487 SRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 SRITIHW SFY N GVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEW 59 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.6 bits (118), Expect = 1e-06 Identities = 30/59 (50%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 487 SRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 SRITIHW SFY PGVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFA-SWRNSEKARTDRPSQQLRSLNGEW 59 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.6 bits (118), Expect = 1e-06 Identities = 30/59 (50%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +1 Query: 487 SRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 SRITIHW SFY N GVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEW 59 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 51.2 bits (117), Expect = 1e-06 Identities = 29/73 (39%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Frame = +1 Query: 454 GGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPS 630 G A P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS Sbjct: 38 GDAGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPS 96 Query: 631 XQLRXXXANWQIV 669 QLR W+++ Sbjct: 97 QQLRSLNGEWRLM 109 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 1/75 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 88 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 146 Query: 646 XXANWQIVSAKIWLK 690 W+++ ++ K Sbjct: 147 LNGEWRLMRRQVRAK 161 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/72 (38%), Positives = 32/72 (44%) Frame = +3 Query: 504 LGVVLQTS*LGKPWRYPT*SLAAHPLFASWGNNXXGRTDSPFPTVAXLNXELANCKR*NL 683 L VVLQ P LAAHP FASW N+ RTD P + LN E +R Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVR 159 Query: 684 VKIRVXIFVKSS 719 K R+ K S Sbjct: 160 AKQRLYNKAKKS 171 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 192 Query: 646 XXANWQIVSA 675 W+++ A Sbjct: 193 LNGEWRLMRA 202 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Frame = +1 Query: 448 TRGGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIR 624 TR P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A R Sbjct: 54 TREACGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDR 112 Query: 625 PSXQLRXXXANWQIV 669 PS QLR W+++ Sbjct: 113 PSQQLRSLNGEWRLM 127 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 1/75 (1%) Frame = +1 Query: 448 TRGGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIR 624 TR P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A R Sbjct: 20 TRSTVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDR 78 Query: 625 PSXQLRXXXANWQIV 669 PS QLR W+++ Sbjct: 79 PSQQLRSLNGEWRLM 93 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = +1 Query: 451 RGGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRP 627 RG P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RP Sbjct: 1 RGEYGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP 59 Query: 628 SXQLRXXXANWQIV 669 S QLR W+++ Sbjct: 60 SQQLRSLNGEWRLM 73 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 505 WASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANWQIV 669 W S Y RDW N GVTQLNRL H+PF + ++ A RPS Q+R W+++ Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPF-VSWRNSEEARTDRPSQQMRSLNGEWRLM 272 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 50.4 bits (115), Expect = 2e-06 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +1 Query: 451 RGGARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRP 627 RGG P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RP Sbjct: 84 RGGD--PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRP 140 Query: 628 SXQLRXXXANWQIV 669 S QLR W+++ Sbjct: 141 SQQLRSLNGEWRLM 154 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 463 RYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQL 639 R P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QL Sbjct: 94 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQL 152 Query: 640 RXXXANWQIV 669 R W+++ Sbjct: 153 RSLNGEWRLM 162 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = +1 Query: 484 VSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 +SRIT A +RRDW N GVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 88 LSRITNSLAVVLQRRDWENTGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEW 146 Query: 661 QIV 669 +++ Sbjct: 147 RLM 149 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 463 RYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQL 639 R P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QL Sbjct: 57 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQL 115 Query: 640 RXXXANWQIV 669 R W+++ Sbjct: 116 RSLNGEWRLM 125 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 463 RYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQL 639 R P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QL Sbjct: 7 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQL 65 Query: 640 RXXXANWQIV 669 R W+++ Sbjct: 66 RSLNGEWRLM 75 >SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/70 (40%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Frame = +1 Query: 463 RYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQL 639 R P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QL Sbjct: 10 RDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQL 68 Query: 640 RXXXANWQIV 669 R W+++ Sbjct: 69 RSLNGEWRLM 78 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +1 Query: 457 GARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSX 633 G P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS Sbjct: 88 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQ 146 Query: 634 QLRXXXANWQIV 669 QLR W+++ Sbjct: 147 QLRSLNGEWRLM 158 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 50.0 bits (114), Expect = 3e-06 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +1 Query: 457 GARYPIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSX 633 G P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS Sbjct: 703 GVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQ 761 Query: 634 QLRXXXANWQIV 669 QLR W+++ Sbjct: 762 QLRSLNGEWRLM 773 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +1 Query: 520 KRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANWQIVSAK 678 +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR W+++ K Sbjct: 56 QRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEWRLMRTK 108 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 108 Query: 646 XXANWQIV 669 W+++ Sbjct: 109 LNGEWRLM 116 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 13 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 71 Query: 646 XXANWQIV 669 W+++ Sbjct: 72 LNGEWRLM 79 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 95 Query: 646 XXANWQIV 669 W+++ Sbjct: 96 LNGEWRLM 103 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 74 Query: 646 XXANWQIV 669 W+++ Sbjct: 75 LNGEWRLM 82 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 17 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 75 Query: 646 XXANWQIV 669 W+++ Sbjct: 76 LNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 64 Query: 646 XXANWQIV 669 W+++ Sbjct: 65 LNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 821 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 879 Query: 646 XXANWQIV 669 W+++ Sbjct: 880 LNGEWRLM 887 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 102 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 160 Query: 646 XXANWQIV 669 W+++ Sbjct: 161 LNGEWRLM 168 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 85 Query: 646 XXANWQIV 669 W+++ Sbjct: 86 LNGEWRLM 93 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 134 Query: 646 XXANWQIV 669 W+++ Sbjct: 135 LNGEWRLM 142 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 83 Query: 646 XXANWQIV 669 W+++ Sbjct: 84 LNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 120 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 178 Query: 646 XXANWQIV 669 W+++ Sbjct: 179 LNGEWRLM 186 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 68 Query: 646 XXANWQIV 669 W+++ Sbjct: 69 LNGEWRLM 76 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 141 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 199 Query: 646 XXANWQIV 669 W+++ Sbjct: 200 LNGEWRLM 207 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 103 Query: 646 XXANWQIV 669 W+++ Sbjct: 104 LNGEWRLM 111 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 67 Query: 646 XXANWQIV 669 W+++ Sbjct: 68 LNGEWRLM 75 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 106 Query: 646 XXANWQIV 669 W+++ Sbjct: 107 LNGEWRLM 114 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 79 Query: 646 XXANWQIV 669 W+++ Sbjct: 80 LNGEWRLM 87 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 94 Query: 646 XXANWQIV 669 W+++ Sbjct: 95 LNGEWRLM 102 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 86 Query: 646 XXANWQIV 669 W+++ Sbjct: 87 LNGEWRLM 94 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 63 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 121 Query: 646 XXANWQIV 669 W+++ Sbjct: 122 LNGEWRLM 129 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 68 Query: 646 XXANWQIV 669 W+++ Sbjct: 69 LNGEWRLM 76 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 103 Query: 646 XXANWQIV 669 W+++ Sbjct: 104 LNGEWRLM 111 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 119 Query: 646 XXANWQIV 669 W+++ Sbjct: 120 LNGEWRLM 127 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 16 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 74 Query: 646 XXANWQIV 669 W+++ Sbjct: 75 LNGEWRLM 82 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 105 Query: 646 XXANWQIV 669 W+++ Sbjct: 106 LNGEWRLM 113 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 134 Query: 646 XXANWQIV 669 W+++ Sbjct: 135 LNGEWRLM 142 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 1178 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 1236 Query: 646 XXANWQIV 669 W+++ Sbjct: 1237 LNGEWRLM 1244 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 628 KGESVRPSXLLPQLAKRGCAA 566 +G SVR S LL QLAK GCAA Sbjct: 414 EGRSVRASSLLRQLAKGGCAA 434 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 641 RNCXEGRIGSAXXVITPAGEKGMCCKRLSW 552 RNC EGR A ++ + G +RLSW Sbjct: 410 RNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 78 Query: 646 XXANWQIV 669 W+++ Sbjct: 79 LNGEWRLM 86 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 113 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 171 Query: 646 XXANWQIV 669 W+++ Sbjct: 172 LNGEWRLM 179 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 65 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 123 Query: 646 XXANWQIV 669 W+++ Sbjct: 124 LNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 77 Query: 646 XXANWQIV 669 W+++ Sbjct: 78 LNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 80 Query: 646 XXANWQIV 669 W+++ Sbjct: 81 LNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 82 Query: 646 XXANWQIV 669 W+++ Sbjct: 83 LNGEWRLM 90 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 84 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 142 Query: 646 XXANWQIV 669 W+++ Sbjct: 143 LNGEWRLM 150 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 49 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 107 Query: 646 XXANWQIV 669 W+++ Sbjct: 108 LNGEWRLM 115 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 130 Query: 646 XXANWQIV 669 W+++ Sbjct: 131 LNGEWRLM 138 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 86 Query: 646 XXANWQIV 669 W+++ Sbjct: 87 LNGEWRLM 94 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 130 Query: 646 XXANWQIV 669 W+++ Sbjct: 131 LNGEWRLM 138 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 72 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 130 Query: 646 XXANWQIV 669 W+++ Sbjct: 131 LNGEWRLM 138 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 67 Query: 646 XXANWQIV 669 W+++ Sbjct: 68 LNGEWRLM 75 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 111 Query: 646 XXANWQIV 669 W+++ Sbjct: 112 LNGEWRLM 119 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 70 Query: 646 XXANWQIV 669 W+++ Sbjct: 71 LNGEWRLM 78 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 70 Query: 646 XXANWQIV 669 W+++ Sbjct: 71 LNGEWRLM 78 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 89 Query: 646 XXANWQIV 669 W+++ Sbjct: 90 LNGEWRLM 97 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 64 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 122 Query: 646 XXANWQIV 669 W+++ Sbjct: 123 LNGEWRLM 130 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 113 Query: 646 XXANWQIV 669 W+++ Sbjct: 114 LNGEWRLM 121 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 79 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 137 Query: 646 XXANWQIV 669 W+++ Sbjct: 138 LNGEWRLM 145 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 87 Query: 646 XXANWQIV 669 W+++ Sbjct: 88 LNGEWRLM 95 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 1051 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 1109 Query: 646 XXANWQIV 669 W+++ Sbjct: 1110 LNGEWRLM 1117 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 63 Query: 646 XXANWQIV 669 W+++ Sbjct: 64 LNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 77 Query: 646 XXANWQIV 669 W+++ Sbjct: 78 LNGEWRLM 85 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 122 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 180 Query: 646 XXANWQIV 669 W+++ Sbjct: 181 LNGEWRLM 188 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 170 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 228 Query: 646 XXANWQIV 669 W+++ Sbjct: 229 LNGEWRLM 236 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 158 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 216 Query: 646 XXANWQIV 669 W+++ Sbjct: 217 LNGEWRLM 224 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 47 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 105 Query: 646 XXANWQIV 669 W+++ Sbjct: 106 LNGEWRLM 113 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 7 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 65 Query: 646 XXANWQIV 669 W+++ Sbjct: 66 LNGEWRLM 73 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 134 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 192 Query: 646 XXANWQIV 669 W+++ Sbjct: 193 LNGEWRLM 200 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 104 Query: 646 XXANWQIV 669 W+++ Sbjct: 105 LNGEWRLM 112 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 104 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 162 Query: 646 XXANWQIV 669 W+++ Sbjct: 163 LNGEWRLM 170 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 11 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 69 Query: 646 XXANWQIV 669 W+++ Sbjct: 70 LNGEWRLM 77 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 640 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 698 Query: 646 XXANWQIV 669 W+++ Sbjct: 699 LNGEWRLM 706 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 85 Query: 646 XXANWQIV 669 W+++ Sbjct: 86 LNGEWRLM 93 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 149 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 207 Query: 646 XXANWQIV 669 W+++ Sbjct: 208 LNGEWRLM 215 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 35 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 93 Query: 646 XXANWQIV 669 W+++ Sbjct: 94 LNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 78 Query: 646 XXANWQIV 669 W+++ Sbjct: 79 LNGEWRLM 86 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 68 Query: 646 XXANWQIV 669 W+++ Sbjct: 69 LNGEWRLM 76 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 104 Query: 646 XXANWQIV 669 W+++ Sbjct: 105 LNGEWRLM 112 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 116 Query: 646 XXANWQIV 669 W+++ Sbjct: 117 LNGEWRLM 124 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 63 Query: 646 XXANWQIV 669 W+++ Sbjct: 64 LNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 106 Query: 646 XXANWQIV 669 W+++ Sbjct: 107 LNGEWRLM 114 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 564 LAAHPLFASWGNNXXGRTDSPFPTVAXLNXE 656 ++AHP FASW N+ RTD P + LN E Sbjct: 15 VSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 59 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 117 Query: 646 XXANWQIV 669 W+++ Sbjct: 118 LNGEWRLM 125 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 125 Query: 646 XXANWQIV 669 W+++ Sbjct: 126 LNGEWRLM 133 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 173 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 231 Query: 646 XXANWQIV 669 W+++ Sbjct: 232 LNGEWRLM 239 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 119 Query: 646 XXANWQIV 669 W+++ Sbjct: 120 LNGEWRLM 127 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 254 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 312 Query: 646 XXANWQIV 669 W+++ Sbjct: 313 LNGEWRLM 320 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 80 Query: 646 XXANWQIV 669 W+++ Sbjct: 81 LNGEWRLM 88 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 58 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 116 Query: 646 XXANWQIV 669 W+++ Sbjct: 117 LNGEWRLM 124 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 92 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 150 Query: 646 XXANWQIV 669 W+++ Sbjct: 151 LNGEWRLM 158 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 109 Query: 646 XXANWQIV 669 W+++ Sbjct: 110 LNGEWRLM 117 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 119 Query: 646 XXANWQIV 669 W+++ Sbjct: 120 LNGEWRLM 127 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 63 Query: 646 XXANWQIV 669 W+++ Sbjct: 64 LNGEWRLM 71 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 62 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 120 Query: 646 XXANWQIV 669 W+++ Sbjct: 121 LNGEWRLM 128 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 129 Query: 646 XXANWQIV 669 W+++ Sbjct: 130 LNGEWRLM 137 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 164 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 222 Query: 646 XXANWQIV 669 W+++ Sbjct: 223 LNGEWRLM 230 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 19 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 77 Query: 646 XXANWQIV 669 W+++ Sbjct: 78 LNGEWRLM 85 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 71 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 129 Query: 646 XXANWQIV 669 W+++ Sbjct: 130 LNGEWRLM 137 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 95 Query: 646 XXANWQIV 669 W+++ Sbjct: 96 LNGEWRLM 103 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 61 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 119 Query: 646 XXANWQIV 669 W+++ Sbjct: 120 LNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 130 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 188 Query: 646 XXANWQIV 669 W+++ Sbjct: 189 LNGEWRLM 196 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 56 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 114 Query: 646 XXANWQIV 669 W+++ Sbjct: 115 LNGEWRLM 122 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 103 Query: 646 XXANWQIV 669 W+++ Sbjct: 104 LNGEWRLM 111 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 115 Query: 646 XXANWQIV 669 W+++ Sbjct: 116 LNGEWRLM 123 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 84 Query: 646 XXANWQIV 669 W+++ Sbjct: 85 LNGEWRLM 92 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 90 Query: 646 XXANWQIV 669 W+++ Sbjct: 91 LNGEWRLM 98 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 27 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRT 85 Query: 646 XXANWQIV 669 W+++ Sbjct: 86 LNGEWRLM 93 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 108 Query: 646 XXANWQIV 669 W+++ Sbjct: 109 LNGEWRLM 116 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 127 Query: 646 XXANWQIV 669 W+++ Sbjct: 128 LNGEWRLM 135 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 179 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 237 Query: 646 XXANWQIV 669 W+++ Sbjct: 238 LNGEWRLM 245 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 75 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 133 Query: 646 XXANWQIV 669 W+++ Sbjct: 134 LNGEWRLM 141 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 26 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 84 Query: 646 XXANWQIV 669 W+++ Sbjct: 85 LNGEWRLM 92 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 38 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 96 Query: 646 XXANWQIV 669 W+++ Sbjct: 97 LNGEWRLM 104 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 37 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 95 Query: 646 XXANWQIV 669 W+++ Sbjct: 96 LNGEWRLM 103 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 29 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 87 Query: 646 XXANWQIV 669 W+++ Sbjct: 88 LNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 10 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 68 Query: 646 XXANWQIV 669 W+++ Sbjct: 69 LNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 172 Query: 646 XXANWQIV 669 W+++ Sbjct: 173 LNGEWRLM 180 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 31 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 89 Query: 646 XXANWQIV 669 W+++ Sbjct: 90 LNGEWRLM 97 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/52 (51%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 508 ASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 A F +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR W Sbjct: 66 AVFLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEW 116 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 115 Query: 646 XXANWQIV 669 W+++ Sbjct: 116 LNGEWRLM 123 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 64 Query: 646 XXANWQIV 669 W+++ Sbjct: 65 LNGEWRLM 72 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 42 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 100 Query: 646 XXANWQIV 669 W+++ Sbjct: 101 LNGEWRLM 108 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 76 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 134 Query: 646 XXANWQIV 669 W+++ Sbjct: 135 LNGEWRLM 142 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 101 Query: 646 XXANWQIV 669 W+++ Sbjct: 102 LNGEWRLM 109 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 104 Query: 646 XXANWQIV 669 W+++ Sbjct: 105 LNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 82 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 140 Query: 646 XXANWQIV 669 W+++ Sbjct: 141 LNGEWRLM 148 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 53 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 111 Query: 646 XXANWQIV 669 W+++ Sbjct: 112 LNGEWRLM 119 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 155 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 213 Query: 646 XXANWQIV 669 W+++ Sbjct: 214 LNGEWRLM 221 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 108 Query: 646 XXANWQIV 669 W+++ Sbjct: 109 LNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 30 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 88 Query: 646 XXANWQIV 669 W+++ Sbjct: 89 LNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 5 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 63 Query: 646 XXANWQIV 669 W+++ Sbjct: 64 LNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 21 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 79 Query: 646 XXANWQIV 669 W+++ Sbjct: 80 LNGEWRLM 87 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 67 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 125 Query: 646 XXANWQIV 669 W+++ Sbjct: 126 LNGEWRLM 133 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 45 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 103 Query: 646 XXANWQIV 669 W+++ Sbjct: 104 LNGEWRLM 111 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 80 Query: 646 XXANWQIV 669 W+++ Sbjct: 81 LNGEWRLM 88 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 93 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 151 Query: 646 XXANWQIV 669 W+++ Sbjct: 152 LNGEWRLM 159 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 34 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 92 Query: 646 XXANWQIV 669 W+++ Sbjct: 93 LNGEWRLM 100 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 24 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 82 Query: 646 XXANWQIV 669 W+++ Sbjct: 83 LNGEWRLM 90 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 107 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 165 Query: 646 XXANWQIV 669 W+++ Sbjct: 166 LNGEWRLM 173 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 140 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 198 Query: 646 XXANWQIV 669 W+++ Sbjct: 199 LNGEWRLM 206 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 90 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 148 Query: 646 XXANWQIV 669 W+++ Sbjct: 149 LNGEWRLM 156 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 22 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 80 Query: 646 XXANWQIV 669 W+++ Sbjct: 81 LNGEWRLM 88 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 72 Query: 646 XXANWQIV 669 W+++ Sbjct: 73 LNGEWRLM 80 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 101 Query: 646 XXANWQIV 669 W+++ Sbjct: 102 LNGEWRLM 109 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 83 Query: 646 XXANWQIV 669 W+++ Sbjct: 84 LNGEWRLM 91 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 102 Query: 646 XXANWQIV 669 W+++ Sbjct: 103 LNGEWRLM 110 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 144 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 202 Query: 646 XXANWQIV 669 W+++ Sbjct: 203 LNGEWRLM 210 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 57 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 115 Query: 646 XXANWQIV 669 W+++ Sbjct: 116 LNGEWRLM 123 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 114 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 172 Query: 646 XXANWQIV 669 W+++ Sbjct: 173 LNGEWRLM 180 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 46 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 104 Query: 646 XXANWQIV 669 W+++ Sbjct: 105 LNGEWRLM 112 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 77 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 135 Query: 646 XXANWQIV 669 W+++ Sbjct: 136 LNGEWRLM 143 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 64 Query: 646 XXANWQIV 669 W+++ Sbjct: 65 LNGEWRLM 72 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 72 Query: 646 XXANWQIV 669 W+++ Sbjct: 73 LNGEWRLM 80 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 131 Query: 646 XXANWQIV 669 W+++ Sbjct: 132 LNGEWRLM 139 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 90 Query: 646 XXANWQIV 669 W+++ Sbjct: 91 LNGEWRLM 98 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 139 Query: 646 XXANWQIV 669 W+++ Sbjct: 140 LNGEWRLM 147 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 133 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 191 Query: 646 XXANWQIV 669 W+++ Sbjct: 192 LNGEWRLM 199 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 49.6 bits (113), Expect = 4e-06 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +1 Query: 520 KRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANWQIVSA 675 +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR W+++ A Sbjct: 796 QRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRSLNGEWRLMRA 847 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 60 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 118 Query: 646 XXANWQIV 669 W+++ Sbjct: 119 LNGEWRLM 126 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 81 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 139 Query: 646 XXANWQIV 669 W+++ Sbjct: 140 LNGEWRLM 147 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 43 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 101 Query: 646 XXANWQIV 669 W+++ Sbjct: 102 LNGEWRLM 109 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 95 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 153 Query: 646 XXANWQIV 669 W+++ Sbjct: 154 LNGEWRLM 161 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 127 Query: 646 XXANWQIV 669 W+++ Sbjct: 128 LNGEWRLM 135 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 96 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 154 Query: 646 XXANWQIV 669 W+++ Sbjct: 155 LNGEWRLM 162 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 294 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 352 Query: 646 XXANWQIV 669 W+++ Sbjct: 353 LNGEWRLM 360 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 76 Query: 646 XXANWQIV 669 W+++ Sbjct: 77 LNGEWRLM 84 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 40 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 98 Query: 646 XXANWQIV 669 W+++ Sbjct: 99 LNGEWRLM 106 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 3 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 61 Query: 646 XXANWQIV 669 W+++ Sbjct: 62 LNGEWRLM 69 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 14 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 72 Query: 646 XXANWQIV 669 W+++ Sbjct: 73 LNGEWRLM 80 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 41 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 99 Query: 646 XXANWQIV 669 W+++ Sbjct: 100 LNGEWRLM 107 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 49.6 bits (113), Expect = 4e-06 Identities = 34/76 (44%), Positives = 40/76 (52%), Gaps = 8/76 (10%) Frame = +1 Query: 457 GARYPIRPIVSRITIHWASFY-------KRRDWXNPGVTQLNRL-QHIPFSPAGVITKXA 612 G YP P SR H S+Y +RRDW NPGVTQLNRL H PF+ + ++ A Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEA 97 Query: 613 EPIRPSXQLRXXXANW 660 RPS QLR W Sbjct: 98 RTDRPSQQLRSLNGEW 113 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 44 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 102 Query: 646 XXANWQIV 669 W+++ Sbjct: 103 LNGEWRLM 110 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 235 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 293 Query: 646 XXANWQIV 669 W+++ Sbjct: 294 LNGEWRLM 301 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 69 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 127 Query: 646 XXANWQIV 669 W+++ Sbjct: 128 LNGEWRLM 135 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 36 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 94 Query: 646 XXANWQIV 669 W+++ Sbjct: 95 LNGEWRLM 102 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 12 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 70 Query: 646 XXANWQIV 669 W+++ Sbjct: 71 LNGEWRLM 78 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 192 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 250 Query: 646 XXANWQIV 669 W+++ Sbjct: 251 LNGEWRLM 258 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 51 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 109 Query: 646 XXANWQIV 669 W+++ Sbjct: 110 LNGEWRLM 117 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 6 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 64 Query: 646 XXANWQIV 669 W+++ Sbjct: 65 LNGEWRLM 72 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 23 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 81 Query: 646 XXANWQIV 669 W+++ Sbjct: 82 LNGEWRLM 89 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 83 Query: 646 XXANWQIV 669 W+++ Sbjct: 84 LNGEWRLM 91 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 18 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 76 Query: 646 XXANWQIV 669 W+++ Sbjct: 77 LNGEWRLM 84 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 73 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 131 Query: 646 XXANWQIV 669 W+++ Sbjct: 132 LNGEWRLM 139 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 20 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 78 Query: 646 XXANWQIV 669 W+++ Sbjct: 79 LNGEWRLM 86 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 97 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 155 Query: 646 XXANWQIV 669 W+++ Sbjct: 156 LNGEWRLM 163 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 9 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 67 Query: 646 XXANWQIV 669 W+++ Sbjct: 68 LNGEWRLM 75 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 25 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 83 Query: 646 XXANWQIV 669 W+++ Sbjct: 84 LNGEWRLM 91 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 186 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 244 Query: 646 XXANWQIV 669 W+++ Sbjct: 245 LNGEWRLM 252 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 48 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 106 Query: 646 XXANWQIV 669 W+++ Sbjct: 107 LNGEWRLM 114 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 4 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 62 Query: 646 XXANWQIV 669 W+++ Sbjct: 63 LNGEWRLM 70 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 15 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 73 Query: 646 XXANWQIV 669 W+++ Sbjct: 74 LNGEWRLM 81 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/48 (56%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +1 Query: 520 KRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRXXXANW 660 +RRDW NPGVTQLNRL H PF+ G K A RPS QLR W Sbjct: 136 QRRDWENPGVTQLNRLAAHPPFASWGNSEK-ARTDRPSQQLRSLNGEW 182 >SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 55 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 113 Query: 646 XXANWQIV 669 W+++ Sbjct: 114 LNGEWRLM 121 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 32 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 90 Query: 646 XXANWQIV 669 W+++ Sbjct: 91 LNGEWRLM 98 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 50 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 108 Query: 646 XXANWQIV 669 W+++ Sbjct: 109 LNGEWRLM 116 >SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 28 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 86 Query: 646 XXANWQIV 669 W+++ Sbjct: 87 LNGEWRLM 94 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/45 (48%), Positives = 28/45 (62%) Frame = -1 Query: 656 FAIXXRNCXEGRIGSAXXVITPAGEKGMCCKRLSWVTPGFXQSRR 522 ++I RNC EGR A ++ + G +RLSWVTPGF QSRR Sbjct: 460 YSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRR 504 >SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 8 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 66 Query: 646 XXANWQIV 669 W+++ Sbjct: 67 LNGEWRLM 74 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 109 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 167 Query: 646 XXANWQIV 669 W+++ Sbjct: 168 LNGEWRLM 175 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 49.6 bits (113), Expect = 4e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +1 Query: 469 PIRPIVSRITIHWASFYKRRDWXNPGVTQLNRL-QHIPFSPAGVITKXAEPIRPSXQLRX 645 P+ ++ A +RRDW NPGVTQLNRL H PF+ + ++ A RPS QLR Sbjct: 352 PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA-SWRNSEEARTDRPSQQLRS 410 Query: 646 XXANWQIV 669 W+++ Sbjct: 411 LNGEWRLM 418 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,738,419 Number of Sequences: 59808 Number of extensions: 540300 Number of successful extensions: 7986 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5193 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2931631446 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -