BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0177.Seq (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 4.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 4.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 5.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 633 KSSARYGGDQQLHW 674 K ARYG DQQ W Sbjct: 573 KCRARYGLDQQNQW 586 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 633 KSSARYGGDQQLHW 674 K ARYG DQQ W Sbjct: 465 KCRARYGLDQQNQW 478 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 470 VRFCXCRPXFCDQKTAEQR 414 + F C C QK AE+R Sbjct: 345 ISFMACSSAGCSQKVAEER 363 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -2 Query: 285 GKAQSSHQSVFTCTVQSNSTRSGRDIYRSLILTRHHGNILA 163 GK + + C S RS ++ + T+H+ NI++ Sbjct: 469 GKGAEQTRQILKCMWCGQSFRSLAEMTSHMQQTQHYTNIIS 509 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,628 Number of Sequences: 336 Number of extensions: 3227 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -