BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0176.Seq (901 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 7e-16 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 75 6e-14 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 75 8e-14 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 74 1e-13 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 72 6e-13 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 72 6e-13 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 72 6e-13 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 7e-13 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 7e-13 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 71 1e-12 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 71 1e-12 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 71 1e-12 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 71 1e-12 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 71 1e-12 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 71 1e-12 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 71 1e-12 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 71 1e-12 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 71 1e-12 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 71 1e-12 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 71 1e-12 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 71 1e-12 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 71 1e-12 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 71 1e-12 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 71 1e-12 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 71 1e-12 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 71 1e-12 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 71 1e-12 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 71 1e-12 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 71 1e-12 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 71 1e-12 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 71 1e-12 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 71 1e-12 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 71 1e-12 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 71 1e-12 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 71 1e-12 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 71 1e-12 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 71 1e-12 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 71 1e-12 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 71 1e-12 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 71 1e-12 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 71 1e-12 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 71 1e-12 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 71 1e-12 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 71 1e-12 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 71 1e-12 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 71 1e-12 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 71 1e-12 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 71 1e-12 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 71 1e-12 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 71 1e-12 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 71 1e-12 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 71 1e-12 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 71 1e-12 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 71 1e-12 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 71 1e-12 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 71 1e-12 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 71 1e-12 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 71 1e-12 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 71 1e-12 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 71 1e-12 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 71 1e-12 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 71 1e-12 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 71 1e-12 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 71 1e-12 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 71 1e-12 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 71 1e-12 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 71 1e-12 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 71 1e-12 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 71 1e-12 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 71 1e-12 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 71 1e-12 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 71 1e-12 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 71 1e-12 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 71 1e-12 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 71 1e-12 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 71 1e-12 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 71 1e-12 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 71 1e-12 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25610| Best HMM Match : MAT_Alpha1 (HMM E-Value=7.2) 71 1e-12 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 71 1e-12 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25265| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 71 1e-12 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 71 1e-12 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24401| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 95.5 bits (227), Expect = 5e-20 Identities = 42/58 (72%), Positives = 44/58 (75%) Frame = -3 Query: 548 CATVGKGDRCGPLXITPAGERGMCCKAIKLGNARVFPVTTL*NDGPXNCNTTXYXANW 375 CATVGKGDRCG ITPAGERGMCCKAIKLGNA+ FP + P NCNTT Y ANW Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 81.8 bits (193), Expect = 7e-16 Identities = 45/75 (60%), Positives = 52/75 (69%), Gaps = 1/75 (1%) Frame = -1 Query: 574 YNLPFAXQXAQLL-GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVI 398 + PFA Q AQLL GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---A 63 Query: 397 RLXXGRIGYRAPPYS 353 +L ++ R P+S Sbjct: 64 KLACLQVDSRGSPFS 78 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 81.4 bits (192), Expect = 9e-16 Identities = 45/77 (58%), Positives = 51/77 (66%), Gaps = 1/77 (1%) Frame = -1 Query: 574 YNLPFAXQXAQLL-GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVI 398 + PFA Q AQL GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---A 63 Query: 397 RLXXGRIGYRAPPYSFR 347 +L ++ R PY R Sbjct: 64 KLACLQVDSRGSPYGLR 80 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 79.0 bits (186), Expect = 5e-15 Identities = 44/82 (53%), Positives = 51/82 (62%), Gaps = 1/82 (1%) Frame = -1 Query: 574 YNLPFAXQXAQLL-GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVI 398 + PFA Q AQL GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT + Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLA 66 Query: 397 RLXXGRIGYRAPPYSFRLRGLV 332 L G + + GL+ Sbjct: 67 CLQVDSRGSPGGKFEVAIFGLI 88 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 77.0 bits (181), Expect = 2e-14 Identities = 38/68 (55%), Positives = 44/68 (64%) Frame = -3 Query: 578 RLQFAIRXSVCATVGKGDRCGPLXITPAGERGMCCKAIKLGNARVFPVTTL*NDGPXNCN 399 R+ FAI+ + +G+ G ITPAGERGMCCKAIKLGNA VFP + P NCN Sbjct: 2 RVPFAIQAA--QLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCN 59 Query: 398 TTXYXANW 375 TT Y ANW Sbjct: 60 TTHYRANW 67 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 75.4 bits (177), Expect = 6e-14 Identities = 46/86 (53%), Positives = 52/86 (60%), Gaps = 1/86 (1%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPPY 356 GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R P Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPQ 63 Query: 355 SFRLRGLVRVPYRYF-SSLXARAGSG 281 R R VR+ YR R GSG Sbjct: 64 GPRQRLRVRLRYRICRERQYPRPGSG 89 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 546 RNCWEGRSVRXSSYYASWRKG 484 RNCWEGRSVR SS KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 74.9 bits (176), Expect = 8e-14 Identities = 34/58 (58%), Positives = 38/58 (65%) Frame = -3 Query: 518 GPLXITPAGERGMCCKAIKLGNARVFPVTTL*NDGPXNCNTTXYXANWXPGPPVLIPI 345 G ITPAGERGMCCKAIKLGNA VFP + P NCNTT Y ANW V++ + Sbjct: 6 GLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANWSSTASVILAV 63 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 74.1 bits (174), Expect = 1e-13 Identities = 40/72 (55%), Positives = 45/72 (62%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPPY 356 GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R PY Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPY 63 Query: 355 SFRLRGLVRVPY 320 VPY Sbjct: 64 ENMANSETGVPY 75 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 546 RNCWEGRSVRXSSYYASWRKG 484 RNCWEGRSVR SS KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 74.1 bits (174), Expect = 1e-13 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKRXAPIALPNSCA 548 VVLQRRDWENPGVTQLNRLAAHPPFASWRN + +SCA Sbjct: 56 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSCA 99 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPS 535 NSP ESYYN LA P + PF EE RTDRPS Sbjct: 43 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPS 95 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 73.7 bits (173), Expect = 2e-13 Identities = 41/66 (62%), Positives = 46/66 (69%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPPY 356 GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R PY Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPY 63 Query: 355 SFRLRG 338 RLRG Sbjct: 64 --RLRG 67 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 546 RNCWEGRSVRXSSYYASWRKG 484 RNCWEGRSVR SS KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 73.7 bits (173), Expect = 2e-13 Identities = 39/64 (60%), Positives = 44/64 (68%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPPY 356 GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R PY Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPY 63 Query: 355 SFRL 344 S L Sbjct: 64 SHHL 67 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 546 RNCWEGRSVRXSSYYASWRKG 484 RNCWEGRSVR SS KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 72.5 bits (170), Expect = 4e-13 Identities = 39/74 (52%), Positives = 48/74 (64%), Gaps = 2/74 (2%) Frame = -1 Query: 607 FXVEXXQXISAYNLPFAXQXAQLL-GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSR 431 F E + +S + P+ + GR++ A LRQLAKGGCAARRLSWVTPGFSQSR Sbjct: 512 FAFEGHESVSRNSTPYTQRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSR 570 Query: 430 RCKTTGQXI-VIRL 392 RCKTT +I+L Sbjct: 571 RCKTTASEFDIIKL 584 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 72.5 bits (170), Expect = 4e-13 Identities = 38/61 (62%), Positives = 43/61 (70%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPPY 356 GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R PY Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPY 63 Query: 355 S 353 S Sbjct: 64 S 64 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 546 RNCWEGRSVRXSSYYASWRKG 484 RNCWEGRSVR SS KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 72.5 bits (170), Expect = 4e-13 Identities = 41/77 (53%), Positives = 50/77 (64%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPPY 356 GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT +L ++ R P Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS---AKLACLQVDSRGSPC 63 Query: 355 SFRLRGLVRVPYRYFSS 305 + +G P RY++S Sbjct: 64 ATVGKGDRCGPLRYYAS 80 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 575 LQFAIRXSVCATVGKGDRCGPLXITPAGERG 483 LQ R S CATVGKGDRCGPL + +G Sbjct: 54 LQVDSRGSPCATVGKGDRCGPLRYYASWRKG 84 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 507 YYASWRKGDVLQG 469 YYASWRKGDVLQG Sbjct: 77 YYASWRKGDVLQG 89 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 546 RNCWEGRSVRXSSYYASWRKG 484 RNCWEGRSVR SS KG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 72.1 bits (169), Expect = 6e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKR 515 VVLQRRDWENPGVTQLNRLAAHPPFASWRN ++ Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRNNEK 83 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/58 (43%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF E+ RTDRPSQQLR L GEW Sbjct: 43 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNEKARTDRPSQQLRSLNGEW 100 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 72.1 bits (169), Expect = 6e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKR 515 VVLQRRDWENPGVTQLNRLAAHPPFASWRN ++ Sbjct: 49 VVLQRRDWENPGVTQLNRLAAHPPFASWRNNEK 81 Score = 46.8 bits (106), Expect = 2e-05 Identities = 28/63 (44%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF E+ RTDRPSQQLR L Sbjct: 36 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNNEKARTDRPSQQLRSLN 95 Query: 557 GEW 565 GEW Sbjct: 96 GEW 98 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 72.1 bits (169), Expect = 6e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKR 515 VVLQRRDWENPGVTQLNRLAAHPPFASWRN ++ Sbjct: 125 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 157 Score = 46.8 bits (106), Expect = 2e-05 Identities = 28/63 (44%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF E+ RTDRPSQQLR L Sbjct: 112 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLN 171 Query: 557 GEW 565 GEW Sbjct: 172 GEW 174 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 72.1 bits (169), Expect = 6e-13 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKRXAPIALPNSCA 548 VVLQRRDWENPGVTQLNRLAAHPPFASWRN + CA Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCA 74 Score = 35.1 bits (77), Expect = 0.078 Identities = 23/55 (41%), Positives = 24/55 (43%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQ 541 NSP ESYYN LA P + PF EE RTDRPSQQ Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 72 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 72.1 bits (169), Expect = 6e-13 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKRXAPIALPNSCA 548 VVLQRRDWENPGVTQLNRLAAHPPFASWRN + CA Sbjct: 514 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCA 557 Score = 35.1 bits (77), Expect = 0.078 Identities = 23/55 (41%), Positives = 24/55 (43%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQ 541 NSP ESYYN LA P + PF EE RTDRPSQQ Sbjct: 501 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 555 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 72.1 bits (169), Expect = 6e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKR 515 VVLQRRDWENPGVTQLNRLAAHPPFASWRN ++ Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEK 92 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/58 (43%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF E+ RTDRPSQQLR L GEW Sbjct: 52 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 109 >SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.7 bits (168), Expect = 7e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRNXKR 515 VVLQRRDWENPGVTQLNRLAAHPPFASWRN ++ Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEQ 70 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/58 (43%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF E+ RTDRPSQQLR L GEW Sbjct: 30 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEQARTDRPSQQLRSLNGEW 87 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 71.7 bits (168), Expect = 7e-13 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = -1 Query: 505 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPPY 356 LRQLAKGGCAARRLSWVTPGFSQSRRCKTT + L G A PY Sbjct: 10 LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPAVPY 59 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 66 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 29 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 64 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 93 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 87 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 46 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 75 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 33 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 92 Query: 557 GEW 565 GEW Sbjct: 93 GEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 30 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 64 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 93 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 56 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 69 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 98 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 56 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 557 GEW 565 GEW Sbjct: 116 GEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 69 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 32 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 89 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 47 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 557 GEW 565 GEW Sbjct: 107 GEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 72 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 101 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 64 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 121 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 48 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 77 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 40 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 66 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 557 GEW 565 GEW Sbjct: 84 GEW 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 27 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 56 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 50 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 557 GEW 565 GEW Sbjct: 99 GEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 61 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 90 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 48 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 107 Query: 557 GEW 565 GEW Sbjct: 108 GEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 55 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 84 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 47 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 71 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 100 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 63 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 88 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 51 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 71 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 557 GEW 565 GEW Sbjct: 89 GEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 218 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 247 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 205 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 264 Query: 557 GEW 565 GEW Sbjct: 265 GEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 113 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 142 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 100 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 159 Query: 557 GEW 565 GEW Sbjct: 160 GEW 162 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 80 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 74 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 103 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 30 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 59 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 82 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 47 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 49 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 78 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 36 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 95 Query: 557 GEW 565 GEW Sbjct: 96 GEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 383 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 412 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 370 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 429 Query: 557 GEW 565 GEW Sbjct: 430 GEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 54 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 109 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 138 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 101 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 158 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 85 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 114 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 77 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 70 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 557 GEW 565 GEW Sbjct: 88 GEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 10 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 39 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 2 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 20 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 49 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 43 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 69 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 27 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 557 GEW 565 GEW Sbjct: 87 GEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 105 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 134 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 97 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 47 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 76 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 34 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 557 GEW 565 GEW Sbjct: 94 GEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 342 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 371 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 329 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 388 Query: 557 GEW 565 GEW Sbjct: 389 GEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 82 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 111 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 69 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 128 Query: 557 GEW 565 GEW Sbjct: 129 GEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 557 GEW 565 GEW Sbjct: 99 GEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 47 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 61 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 90 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 48 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 107 Query: 557 GEW 565 GEW Sbjct: 108 GEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 557 GEW 565 GEW Sbjct: 92 GEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 136 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 165 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 123 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 182 Query: 557 GEW 565 GEW Sbjct: 183 GEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 65 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 94 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 52 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 111 Query: 557 GEW 565 GEW Sbjct: 112 GEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 70 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 557 GEW 565 GEW Sbjct: 88 GEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 145 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 174 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 137 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 194 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 835 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 864 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 858 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 887 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 47 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 62 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 91 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 54 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 65 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 28 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 75 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 104 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 67 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 58 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 87 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 50 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 71 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 100 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 63 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 258 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 287 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 245 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 304 Query: 557 GEW 565 GEW Sbjct: 305 GEW 307 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 116 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 145 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 139 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 168 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 81 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 44 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 557 GEW 565 GEW Sbjct: 85 GEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 68 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 31 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 103 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 132 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 95 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 116 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 145 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 103 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 162 Query: 557 GEW 565 GEW Sbjct: 163 GEW 165 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 70 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 64 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 93 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 22 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 51 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 45 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 89 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 52 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 68 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEW 565 PF EE RTDRPSQQLR L GEW Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 65 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 557 GEW 565 GEW Sbjct: 83 GEW 85 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 13 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 42 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 36 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 65 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 21 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 50 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 44 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 398 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 427 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 385 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 444 Query: 557 GEW 565 GEW Sbjct: 445 GEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 47 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 76 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 39 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 56 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 85 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 48 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 30 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 121 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 150 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 108 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 167 Query: 557 GEW 565 GEW Sbjct: 168 GEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 57 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 86 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 49 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 67 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 96 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 59 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 70 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 99 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 62 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 119 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 71.3 bits (167), Expect = 1e-12 Identities = 37/59 (62%), Positives = 40/59 (67%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSWVTPGFSQSRRCKTTGQXIVIRLXXGRIGYRAPP 359 GR++ A LRQLAKGGCAARRLSWVTPGFSQSRRCKTT + L G PP Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPP 87 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 564 HSPXSXRNCWEGRSVRXSSYYASWRKG 484 HSP RNCWEGRSVR SS KG Sbjct: 19 HSPFRLRNCWEGRSVRASSLLRQLAKG 45 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 416 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 445 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 403 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 462 Query: 557 GEW 565 GEW Sbjct: 463 GEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 113 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 142 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 105 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 69 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 98 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 61 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 58 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 87 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 45 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 557 GEW 565 GEW Sbjct: 105 GEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 48 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 77 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 35 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 557 GEW 565 GEW Sbjct: 95 GEW 97 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 163 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 192 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 155 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 67 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 96 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 59 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 54 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 83 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 46 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 103 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 90 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 68 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 62 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 65 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 94 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 52 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 111 Query: 557 GEW 565 GEW Sbjct: 112 GEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 44 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 73 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 36 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 187 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 216 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 174 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 233 Query: 557 GEW 565 GEW Sbjct: 234 GEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 65 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 23 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 557 GEW 565 GEW Sbjct: 83 GEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 71 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 557 GEW 565 GEW Sbjct: 89 GEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 56 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 85 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 43 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 557 GEW 565 GEW Sbjct: 103 GEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 53 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 82 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 40 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 99 Query: 557 GEW 565 GEW Sbjct: 100 GEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 65 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 28 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 66 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 557 GEW 565 GEW Sbjct: 84 GEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 80 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 557 GEW 565 GEW Sbjct: 98 GEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 41 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 70 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 28 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 557 GEW 565 GEW Sbjct: 88 GEW 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 134 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 163 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 157 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 43 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 72 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 35 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 86 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 115 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 73 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 132 Query: 557 GEW 565 GEW Sbjct: 133 GEW 135 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 24 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 53 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 155 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 184 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 178 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 207 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 342 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 371 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 329 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 388 Query: 557 GEW 565 GEW Sbjct: 389 GEW 391 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 88 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 23 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 52 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 46 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 49 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 78 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 72 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 111 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 140 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 103 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 88 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 117 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 75 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 134 Query: 557 GEW 565 GEW Sbjct: 135 GEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 557 GEW 565 GEW Sbjct: 85 GEW 87 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 62 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 91 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 85 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 296 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 325 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 283 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 342 Query: 557 GEW 565 GEW Sbjct: 343 GEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 88 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 46 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 557 GEW 565 GEW Sbjct: 106 GEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 60 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 89 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 52 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 47 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 30 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 413 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 442 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 400 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 459 Query: 557 GEW 565 GEW Sbjct: 460 GEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 97 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 126 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 89 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 53 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 82 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 40 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 99 Query: 557 GEW 565 GEW Sbjct: 100 GEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 557 GEW 565 GEW Sbjct: 92 GEW 94 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 95 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 124 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 82 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 141 Query: 557 GEW 565 GEW Sbjct: 142 GEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 37 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 213 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 242 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 200 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 259 Query: 557 GEW 565 GEW Sbjct: 260 GEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 557 GEW 565 GEW Sbjct: 92 GEW 94 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 215 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 244 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 238 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 267 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 35 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 64 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 58 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 50 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 79 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 73 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 102 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 69 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 32 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 557 GEW 565 GEW Sbjct: 92 GEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 149 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 178 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 141 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 47 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 76 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 34 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 557 GEW 565 GEW Sbjct: 94 GEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 37 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 66 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 24 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 557 GEW 565 GEW Sbjct: 84 GEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 57 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 86 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 49 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 71 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 77 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 106 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 100 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 129 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 197 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 226 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 184 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 243 Query: 557 GEW 565 GEW Sbjct: 244 GEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 55 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 84 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 42 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 101 Query: 557 GEW 565 GEW Sbjct: 102 GEW 104 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 34 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 63 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 26 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 88 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 117 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 75 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 134 Query: 557 GEW 565 GEW Sbjct: 135 GEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 24 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 53 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 47 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 80 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 557 GEW 565 GEW Sbjct: 98 GEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 189 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 218 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 176 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 235 Query: 557 GEW 565 GEW Sbjct: 236 GEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 88 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 51 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 69 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 98 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 56 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 557 GEW 565 GEW Sbjct: 116 GEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 81 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 39 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 557 GEW 565 GEW Sbjct: 99 GEW 101 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 59 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 88 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 82 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 111 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 102 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 131 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 154 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 78 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 107 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 65 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 124 Query: 557 GEW 565 GEW Sbjct: 125 GEW 127 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 98 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 127 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 85 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 144 Query: 557 GEW 565 GEW Sbjct: 145 GEW 147 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 75 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 98 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 71 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 29 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 88 Query: 557 GEW 565 GEW Sbjct: 89 GEW 91 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 51 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 80 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 38 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 97 Query: 557 GEW 565 GEW Sbjct: 98 GEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 665 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 694 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 652 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 711 Query: 557 GEW 565 GEW Sbjct: 712 GEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 50 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 79 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 37 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 96 Query: 557 GEW 565 GEW Sbjct: 97 GEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 39 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 68 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 26 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 557 GEW 565 GEW Sbjct: 86 GEW 88 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 30 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 59 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 53 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 82 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 148 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 177 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/32 (59%), Positives = 22/32 (68%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIVSA 580 PF EE RTDRPSQQLR L GEW+++ A Sbjct: 171 PFASWRNSEEARTDRPSQQLRSLNGEWRLMRA 202 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 40 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 69 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 32 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 61 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 90 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 84 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 113 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 90 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 113 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 142 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 25 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 557 GEW 565 GEW Sbjct: 85 GEW 87 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 102 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 131 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 125 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 154 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 45 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 74 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 32 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 557 GEW 565 GEW Sbjct: 92 GEW 94 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 1192 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 1221 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 1215 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -2 Query: 564 HSPXSXRNCWEGRSVRXSSYYASWRKG 484 HSP RNCWEGRSVR SS KG Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKG 430 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 535 GRAIGAXLFXLRQLAKGGCAARRLSW 458 GR++ A LRQLAKGGCAARRLSW Sbjct: 415 GRSVRASSL-LRQLAKGGCAARRLSW 439 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 44 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 73 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 36 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 34 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 63 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 57 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 127 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 156 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 150 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 179 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 58 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 87 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 50 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 79 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 108 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 102 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 52 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 81 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 44 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 128 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 157 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 120 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 177 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 170 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 199 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 162 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 219 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 33 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 62 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 56 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 82 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 111 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 69 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 128 Query: 557 GEW 565 GEW Sbjct: 129 GEW 131 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 32 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 61 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 19 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLN 78 Query: 557 GEW 565 GEW Sbjct: 79 GEW 81 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 47 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 76 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 34 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 557 GEW 565 GEW Sbjct: 94 GEW 96 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 18 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 47 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 41 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 77 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 106 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 64 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 123 Query: 557 GEW 565 GEW Sbjct: 124 GEW 126 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 927 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 956 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 914 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 973 Query: 557 GEW 565 GEW Sbjct: 974 GEW 976 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 36 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 65 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 59 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 61 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 48 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 77 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 35 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 557 GEW 565 GEW Sbjct: 95 GEW 97 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 38 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 67 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 30 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 98 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 127 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 121 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 150 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 355 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 384 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 342 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 401 Query: 557 GEW 565 GEW Sbjct: 402 GEW 404 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 85 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 114 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 77 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 134 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 67 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 96 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 59 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 77 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 106 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 64 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 123 Query: 557 GEW 565 GEW Sbjct: 124 GEW 126 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) Length = 227 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 10 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 39 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/58 (44%), Positives = 27/58 (46%) Frame = +2 Query: 392 ESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLXGEW 565 ESYYN LA P + PF EE RTDRPSQQLR L GEW Sbjct: 2 ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 63 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 92 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 86 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 86 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 115 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 109 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 138 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 31 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 60 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 18 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 77 Query: 557 GEW 565 GEW Sbjct: 78 GEW 80 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 42 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 71 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +2 Query: 485 PFRQLA*XEEXRTDRPSQQLRXLXGEWQIV 574 PF EE RTDRPSQQLR L GEW+++ Sbjct: 65 PFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 71.3 bits (167), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 417 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 506 VVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 128 VVLQRRDWENPGVTQLNRLAAHPPFASWRN 157 Score = 48.4 bits (110), Expect = 8e-06 Identities = 29/63 (46%), Positives = 30/63 (47%) Frame = +2 Query: 377 NSPXXESYYNXLARRFTTS*LGKPWRYPT*SPCSTSPFRQLA*XEEXRTDRPSQQLRXLX 556 NSP ESYYN LA P + PF EE RTDRPSQQLR L Sbjct: 115 NSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 174 Query: 557 GEW 565 GEW Sbjct: 175 GEW 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,687,864 Number of Sequences: 59808 Number of extensions: 414299 Number of successful extensions: 12672 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11101 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -