BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0175.Seq (870 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Ma... 27 4.6 SPCC1450.04 |tef5||translation elongation factor EF-1 beta subun... 26 8.0 >SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Manual Length = 358 Score = 26.6 bits (56), Expect = 4.6 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = -3 Query: 298 SSNPTLRSVPLAATXVATGLAPSTGKRPRSRRTWTGVVATRKRNLPNTTS 149 SS P SVP +++ ++ P+T P + T T +P+++S Sbjct: 95 SSTPITASVPTSSSILSNSTIPTTSPVPTTSSTPTSSSILSNSTIPSSSS 144 >SPCC1450.04 |tef5||translation elongation factor EF-1 beta subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 214 Score = 25.8 bits (54), Expect = 8.0 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -3 Query: 265 AATXVATGLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPV 143 A A G+AP T K P R + + LP T V Sbjct: 35 AVVFKAVGVAPDTAKYPNGARWYKQIATYDLATLPGTAKEV 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,869,415 Number of Sequences: 5004 Number of extensions: 49033 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 434475230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -