BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0175.Seq (870 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 25 3.0 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 24 6.9 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 9.2 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 9.2 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 9.2 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 25.0 bits (52), Expect = 3.0 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 Query: 244 GLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 137 G P ++ R W GV+ KR P S ++D Sbjct: 406 GKKPPNNPLEKTNRLWGGVINDIKRRYPMYKSDIMD 441 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.8 bits (49), Expect = 6.9 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 289 PTLRSV-PLAATXVATGLAPSTGKRPRSRRTWTGVVATRKRNLPNTTSP 146 PT +V P T TG P T + P S +T P TT P Sbjct: 415 PTTSTVAPGTTTTTPTGANPGTTQPPTSDAPNHTTTSTTTEGNPGTTRP 463 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 241 LAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 137 + P + PR WTGV+ T PN+ ++D Sbjct: 201 VGPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 233 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 241 LAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 137 + P + PR WTGV+ T PN+ ++D Sbjct: 201 VGPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 233 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.4 bits (48), Expect = 9.2 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -3 Query: 241 LAPSTGKRPRSRRTWTGVVATRKRNLPNTTSPVID 137 + P + PR WTGV+ T PN+ ++D Sbjct: 87 VGPLRFRHPRPAEKWTGVLNT--TTPPNSCVQIVD 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 732,946 Number of Sequences: 2352 Number of extensions: 12522 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93026475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -