BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0175.Seq (870 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21317-4|AAA62523.1| 719|Caenorhabditis elegans Hypothetical pr... 32 0.61 AF099921-1|AAC68807.1| 1286|Caenorhabditis elegans Hypothetical ... 29 3.3 AF040650-3|ABE73333.1| 836|Caenorhabditis elegans Hypothetical ... 29 5.7 AF040650-2|AAT81190.1| 939|Caenorhabditis elegans Hypothetical ... 29 5.7 AF040650-1|AAB95011.1| 952|Caenorhabditis elegans Hypothetical ... 29 5.7 >U21317-4|AAA62523.1| 719|Caenorhabditis elegans Hypothetical protein B0495.2 protein. Length = 719 Score = 31.9 bits (69), Expect = 0.61 Identities = 19/50 (38%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 296 KQPDSKERPSRRDXRR--YGPGTLYGKTAPFKTNLDRSRRDEKAEPPEHH 153 K+ D K +RD RR GP K FK +RS RD+K HH Sbjct: 87 KERDKKREKDKRDDRRDVRGPDARQ-KDRDFKGRQERSGRDQKVHEHRHH 135 >AF099921-1|AAC68807.1| 1286|Caenorhabditis elegans Hypothetical protein M01E10.2 protein. Length = 1286 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = -3 Query: 289 PTLRSVPLAATXVATGLAPSTGKRPRSRRT---WTGVVATRKRNLPNTTSPVI 140 PT+++ P T ST + PR+++T WT T ++ P T +P I Sbjct: 369 PTIQTPPPTTQTPPTTQTSSTTQTPRTKQTWAPWTPPTTTTRQTPPTTQAPPI 421 >AF040650-3|ABE73333.1| 836|Caenorhabditis elegans Hypothetical protein T04B8.5c protein. Length = 836 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 715 RDNHGSRRNYHRKLISRHLKDASPVL--DHAICKSYPDSSKLTTSDARPSVD 566 +D H R L + ++ S V+ DH +C P ++ + + A PSVD Sbjct: 716 QDMHRRERQLKNMLQTLRIEGESSVVPWDHVVCHYQPPNATASANTATPSVD 767 >AF040650-2|AAT81190.1| 939|Caenorhabditis elegans Hypothetical protein T04B8.5b protein. Length = 939 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 715 RDNHGSRRNYHRKLISRHLKDASPVL--DHAICKSYPDSSKLTTSDARPSVD 566 +D H R L + ++ S V+ DH +C P ++ + + A PSVD Sbjct: 819 QDMHRRERQLKNMLQTLRIEGESSVVPWDHVVCHYQPPNATASANTATPSVD 870 >AF040650-1|AAB95011.1| 952|Caenorhabditis elegans Hypothetical protein T04B8.5a protein. Length = 952 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 715 RDNHGSRRNYHRKLISRHLKDASPVL--DHAICKSYPDSSKLTTSDARPSVD 566 +D H R L + ++ S V+ DH +C P ++ + + A PSVD Sbjct: 832 QDMHRRERQLKNMLQTLRIEGESSVVPWDHVVCHYQPPNATASANTATPSVD 883 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,894,841 Number of Sequences: 27780 Number of extensions: 274112 Number of successful extensions: 737 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2181923744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -