BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0175.Seq (870 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 25 1.2 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 24 2.1 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 2.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 2.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 2.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 2.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 2.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 2.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 2.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 2.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 2.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 2.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 2.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 2.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 2.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 2.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 2.8 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 4.8 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 24.6 bits (51), Expect = 1.2 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 604 MNLDNFCRSHGQVPATHLSNVCLSTFDGSFCDYHGCHG 717 + L N S G H+SN LS +G F + HG Sbjct: 393 VELANKMESSGMAGRVHISNATLSFLNGEF-EVEPAHG 429 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.8 bits (49), Expect = 2.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 586 PKSLILMNLDNFCRSHGQVPAT 651 P+ L +NL + CR HG PAT Sbjct: 430 PRELEAVNLGSACRIHGS-PAT 450 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 101 PRPIMVRPWVPMRGQVPGSRHIG 123 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 101 PRPIMVRPWVPMRGQVPGSRHIG 123 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 101 PRPIMVRPWVPMRGQVPGSRHIG 123 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 101 PRPIMVRPWVPMRGQVPGSRHIG 123 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 101 PRPIMVRPWVPMRGQVPGSRHIG 123 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 101 PRPIMVRPWVPMRGQVPGSRHIG 123 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 101 PRPIMVRPWVPMRGQVPGSRHIG 123 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 350 PRPIMVRPWVPMRGQVPGSRHIG 372 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 350 PRPIMVRPWVPMRGQVPGSRHIG 372 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 350 PRPIMVRPWVPMRGQVPGSRHIG 372 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 350 PRPIMVRPWVPMRGQVPGSRHIG 372 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 350 PRPIMVRPWVPMRGQVPGSRHIG 372 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 350 PRPIMVRPWVPMRGQVPGSRHIG 372 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 349 PRPIMVRPWVPMRGQVPGSRHIG 371 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 334 PRPIMVRPWVPMRGQVPGSRHIG 356 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.4 bits (48), Expect = 2.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 264 PRPSSLRAWHPLRENGPVQDELG 196 PRP +R W P+R P +G Sbjct: 350 PRPIMVRPWVPMRGQVPGSRHIG 372 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.6 bits (46), Expect = 4.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 153 HLPLSIKTTGFSAGLYSCSLXATKE 79 H PLS+K G GL L T + Sbjct: 319 HTPLSVKFPGMGHGLQPPDLAGTSQ 343 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,989 Number of Sequences: 438 Number of extensions: 3738 Number of successful extensions: 29 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28159464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -