BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0173.Seq (822 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||... 27 3.2 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 25 9.8 SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 25 9.8 >SPAC1786.02 |||phospholipase |Schizosaccharomyces pombe|chr 1|||Manual Length = 644 Score = 27.1 bits (57), Expect = 3.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 456 FWGRGAVKH*IGTLKGAP 509 +WGR +H +G L+G P Sbjct: 227 YWGRAIARHFVGQLRGGP 244 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 25.4 bits (53), Expect = 9.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 383 SPRSLIVDSCSKLEQHSTLXRSILLI 306 SP +L +CS L HST + L+ Sbjct: 28 SPNNLTEQTCSPLRAHSTFKEPVFLL 53 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 25.4 bits (53), Expect = 9.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 446 RVMVHVVGHRPDRRFXAL*RWSPRSLIVDSCSK 348 + +V + PD +F + W P L + SC K Sbjct: 210 KFLVKLAKALPDAKFFGIFDWDPHGLCIYSCFK 242 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,724,736 Number of Sequences: 5004 Number of extensions: 49789 Number of successful extensions: 91 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 402440190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -