BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0173.Seq (822 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 2e-30 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 123 2e-28 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 120 1e-27 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 119 3e-27 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 116 3e-26 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 3e-26 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 3e-26 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 5e-26 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 114 7e-26 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 114 7e-26 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 110 2e-24 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 3e-24 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 5e-24 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 6e-23 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 1e-22 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 9e-22 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 4e-20 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 8e-20 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 91 1e-18 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 88 9e-18 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 5e-17 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 84 1e-16 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 84 2e-16 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 83 2e-16 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 83 2e-16 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 83 3e-16 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 83 3e-16 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 83 3e-16 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 83 3e-16 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 83 3e-16 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 83 3e-16 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 83 3e-16 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 83 3e-16 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 83 3e-16 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 83 3e-16 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 83 3e-16 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 83 3e-16 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 83 3e-16 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 83 3e-16 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 83 3e-16 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 83 3e-16 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 83 3e-16 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 83 3e-16 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 83 3e-16 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 83 3e-16 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 83 3e-16 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 83 3e-16 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 83 3e-16 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 83 3e-16 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 83 3e-16 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 83 3e-16 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 83 3e-16 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 83 3e-16 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 83 3e-16 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 83 3e-16 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 83 3e-16 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 83 3e-16 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 83 3e-16 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 83 3e-16 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 83 3e-16 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 83 3e-16 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 83 3e-16 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 83 3e-16 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 83 3e-16 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 83 3e-16 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 83 3e-16 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 83 3e-16 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_29747| Best HMM Match : Ank (HMM E-Value=0) 83 3e-16 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 83 3e-16 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 83 3e-16 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 83 3e-16 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 83 3e-16 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 83 3e-16 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 83 3e-16 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 82 5e-16 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 82 5e-16 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 82 5e-16 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 82 5e-16 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 82 5e-16 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 82 5e-16 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 82 5e-16 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 82 5e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 82 5e-16 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 82 5e-16 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 82 5e-16 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 81 1e-15 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 81 1e-15 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 81 1e-15 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 81 1e-15 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 81 1e-15 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 81 1e-15 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 81 1e-15 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 81 1e-15 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 81 1e-15 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 81 1e-15 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 81 1e-15 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 81 1e-15 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 81 1e-15 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 81 1e-15 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 81 1e-15 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 81 1e-15 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 81 1e-15 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 81 1e-15 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 81 1e-15 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 81 1e-15 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 81 1e-15 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 81 1e-15 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 81 1e-15 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 81 1e-15 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 81 1e-15 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 81 1e-15 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 81 1e-15 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 81 1e-15 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 81 1e-15 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 81 1e-15 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 130 bits (313), Expect = 2e-30 Identities = 58/65 (89%), Positives = 59/65 (90%) Frame = -2 Query: 209 LPFAIAGAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNGQGFPSHDVVKRRPVNCXTTH 30 +PFAI AQLLGRAIGAGLFAITPAGERGMCCKAIKLGN FPSHDVVKRRPVNC TTH Sbjct: 3 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTH 62 Query: 29 YRANW 15 YRANW Sbjct: 63 YRANW 67 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 123 bits (297), Expect = 2e-28 Identities = 54/64 (84%), Positives = 57/64 (89%) Frame = +3 Query: 15 PIRPIVSRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTC 194 PIRPIVSR TIHWP+FYN TGKTLA TQLNRLAAHPPFASWRNS+EAR D PSQQLR+ Sbjct: 39 PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQQLRSL 98 Query: 195 NGEW 206 NGEW Sbjct: 99 NGEW 102 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 120 bits (289), Expect = 1e-27 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGKTL+VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 119 bits (286), Expect = 3e-27 Identities = 56/65 (86%), Positives = 57/65 (87%) Frame = -2 Query: 209 LPFAIAGAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNGQGFPSHDVVKRRPVNCXTTH 30 +PFAI AQLLGRAIGAGLFAITPAGERGMCCKAIKL FPSHDVVKRRPVNC TTH Sbjct: 1836 VPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT-PVFPSHDVVKRRPVNCNTTH 1894 Query: 29 YRANW 15 YRANW Sbjct: 1895 YRANW 1899 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 116 bits (278), Expect = 3e-26 Identities = 51/58 (87%), Positives = 53/58 (91%) Frame = -2 Query: 188 AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNGQGFPSHDVVKRRPVNCXTTHYRANW 15 AQLLGRAIGAGLFAITPAGERGMCCK+IKL + FPSHDVVKRRPVNC TTHYRANW Sbjct: 4 AQLLGRAIGAGLFAITPAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 116 bits (278), Expect = 3e-26 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGK VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 116 bits (278), Expect = 3e-26 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGK VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 115 bits (276), Expect = 5e-26 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGK VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 114 bits (275), Expect = 7e-26 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +3 Query: 48 HWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 HWPSFYN+VTGKTL VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 114 bits (275), Expect = 7e-26 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = -2 Query: 188 AQLLGRAIGAGLFAITPAGERGMCCKAIKLGNGQGFPSHDVVKRRPVNCXTTHYRAN 18 AQLLGR+IGAGLFAITPAGERGMCCKAIKLGN +GFPSHD KRRPVNC TTHYRAN Sbjct: 41 AQLLGRSIGAGLFAITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 110 bits (264), Expect = 2e-24 Identities = 48/52 (92%), Positives = 48/52 (92%) Frame = -2 Query: 170 AIGAGLFAITPAGERGMCCKAIKLGNGQGFPSHDVVKRRPVNCXTTHYRANW 15 AIGAGLFAITPAGERGMCCKAIKLGN FPSHDVVKRRPVNC TTHYRANW Sbjct: 2 AIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 109 bits (263), Expect = 2e-24 Identities = 48/58 (82%), Positives = 51/58 (87%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGKTLA+ L LAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 109 bits (262), Expect = 3e-24 Identities = 47/58 (81%), Positives = 51/58 (87%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN++ KT VTQLNRLAAHPPFASWRNSE+ARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEW 59 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 108 bits (260), Expect = 5e-24 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = -2 Query: 179 LGRAIGAGLFAITPAGERGMCCKAIKLGNGQGFPSHDVVKRRPVNCXTTHYRANW 15 +G+ GLFAITPAGERGMCCKAIKLGN +GFPSHDVVKRRPVNC TTHYRANW Sbjct: 5 VGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 107 bits (257), Expect = 1e-23 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+V + VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 105 bits (251), Expect = 6e-23 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = +3 Query: 18 IRPIVSRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCN 197 IRPIVSR TIHWPSFY + V QLNRLAAHPPFASWR+SEEARTD PSQQLR N Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSEEARTDRPSQQLRRLN 77 Query: 198 GEW 206 GEW Sbjct: 78 GEW 80 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 104 bits (249), Expect = 1e-22 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGKTLA+ L L HPPFASWRNSEEARTD PSQ+LR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 103 bits (246), Expect = 2e-22 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 1/59 (1%) Frame = -2 Query: 188 AQLLGRAIGAGLFAITPAGERGMCCKA-IKLGNGQGFPSHDVVKRRPVNCXTTHYRANW 15 AQLLGRAIGAGLFAITPAGE+G + +KLG QGFPSHDVVKRRPVNC TTHYRANW Sbjct: 44 AQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 101 bits (241), Expect = 9e-22 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGKTLA+ L L PPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 95.9 bits (228), Expect = 4e-20 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +3 Query: 63 YNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 YN+VTGKT VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 94.7 bits (225), Expect = 8e-20 Identities = 43/59 (72%), Positives = 46/59 (77%) Frame = +3 Query: 30 VSRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 +SR TIHWPS + VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 335 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 90.6 bits (215), Expect = 1e-18 Identities = 45/64 (70%), Positives = 46/64 (71%) Frame = +3 Query: 15 PIRPIVSRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTC 194 PIRPIVS TIHWPSFYN VT AHPPFASWRNSEEARTD PSQQLR+ Sbjct: 41 PIRPIVSHITIHWPSFYNGVT-------------AHPPFASWRNSEEARTDRPSQQLRSL 87 Query: 195 NGEW 206 NGEW Sbjct: 88 NGEW 91 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 87.8 bits (208), Expect = 9e-18 Identities = 41/49 (83%), Positives = 41/49 (83%) Frame = -1 Query: 189 CATVGKGXRCGPLRYYASWRKGDVLQGD*VG*RPGFSQSRCCKTTASEL 43 CATVGKG RCGPLRYYASWRKGDVLQG PGFSQSR CKTTASEL Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 85.4 bits (202), Expect = 5e-17 Identities = 40/58 (68%), Positives = 44/58 (75%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGKTLA+ L L P +AS SEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 84.2 bits (199), Expect = 1e-16 Identities = 37/60 (61%), Positives = 43/60 (71%) Frame = +3 Query: 51 WPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 WPS YN VTQLNRL AH PF SWRNSEEARTD PSQQ+R+ NGEW+++ +L Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSWRNSEEARTDRPSQQMRSLNGEWRLMRYFLL 277 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 84.2 bits (199), Expect = 1e-16 Identities = 39/58 (67%), Positives = 44/58 (75%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNILLKFALNFCKSAH 266 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L KS H Sbjct: 85 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCEYEGKSGH 142 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 71 LAVVLQRRDWENPG 84 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 83.8 bits (198), Expect = 2e-16 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLRT NGEW+++ Sbjct: 53 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRLM 93 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 39 LAVVLQRRDWENPG 52 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 83.8 bits (198), Expect = 2e-16 Identities = 45/75 (60%), Positives = 49/75 (65%), Gaps = 7/75 (9%) Frame = +3 Query: 3 GARYPIRPIVSRXTIHWPSFYNIVT-------GKTLAVTQLNRLAAHPPFASWRNSEEAR 161 G YP P SR H S+YN + + VTQLNRLAAHPPFASWRNSEEAR Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 98 Query: 162 TDXPSQQLRTCNGEW 206 TD PSQQLR+ NGEW Sbjct: 99 TDRPSQQLRSLNGEW 113 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 83.4 bits (197), Expect = 2e-16 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVN 224 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ N Sbjct: 1077 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRQN 1120 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 1063 LAVVLQRRDWENPG 1076 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 83.4 bits (197), Expect = 2e-16 Identities = 37/58 (63%), Positives = 44/58 (75%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNILLKFALNFCKSAH 266 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ ++ + C H Sbjct: 543 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRA----RYTITLCIGGH 596 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 529 LAVVLQRRDWENPG 542 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 83.4 bits (197), Expect = 2e-16 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = -2 Query: 215 YNLPFAIAGAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNGQGFP 78 + PFAI AQLLGRAIGAGLFAITPAGERGMCCKAIKLGN + FP Sbjct: 8 HQAPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLGNARVFP 53 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 83.0 bits (196), Expect = 3e-16 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNILLKFAL 245 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L L Sbjct: 847 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLIL 897 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 833 LAVVLQRRDWENPG 846 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = +3 Query: 78 GKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 G+ VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 38 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = +3 Query: 78 GKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 G+ VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 63 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 83.0 bits (196), Expect = 3e-16 Identities = 41/59 (69%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = +3 Query: 33 SRXTIHWPSFYNIVTGK-TLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 SR TIHWPSFYN+VTGK T L L P ASWRNSEEARTD PSQQLR+ NGEW Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASWRNSEEARTDRPSQQLRSLNGEW 60 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = +3 Query: 78 GKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 G+ VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 704 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 746 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 83.0 bits (196), Expect = 3e-16 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = +3 Query: 78 GKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 G+ VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW Sbjct: 75 GENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 117 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 76 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 62 LAVVLQRRDWENPG 75 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 39 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 84 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 25 LAVVLQRRDWENPG 38 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 54 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 63 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 49 LAVVLQRRDWENPG 62 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 42 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 28 LAVVLQRRDWENPG 41 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 128 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 173 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 114 LAVVLQRRDWENPG 127 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 53 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 39 LAVVLQRRDWENPG 52 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 25 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 11 LAVVLQRRDWENPG 24 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 102 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 88 LAVVLQRRDWENPG 101 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 36 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 22 LAVVLQRRDWENPG 35 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 167 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 212 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 153 LAVVLQRRDWENPG 166 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 57 LAVVLQRRDWENPG 70 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 61 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 106 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 L VVLQ RDWENPG Sbjct: 47 LDVVLQRRDWENPG 60 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 74 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 60 LAVVLQRRDWENPG 73 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 227 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 272 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 213 LAVVLQRRDWENPG 226 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 62 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 48 LAVVLQRRDWENPG 61 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 54 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 99 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 40 LAVVLQRRDWENPG 53 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 89 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 134 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 75 LAVVLQRRDWENPG 88 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 36 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 22 LAVVLQRRDWENPG 35 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 57 LAVVLQRRDWENPG 70 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNILLK 236 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ + K Sbjct: 114 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRRQVRAK 161 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 100 LAVVLQRRDWENPG 113 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 87 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 73 LAVVLQRRDWENPG 86 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 42 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 87 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 28 LAVVLQRRDWENPG 41 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 73 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 59 LAVVLQRRDWENPG 72 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 102 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 88 LAVVLQRRDWENPG 101 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 114 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 159 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 100 LAVVLQRRDWENPG 113 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 46 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 32 LAVVLQRRDWENPG 45 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 139 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 184 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 125 LAVVLQRRDWENPG 138 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 110 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 155 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 96 LAVVLQRRDWENPG 109 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 75 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 120 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 61 LAVVLQRRDWENPG 74 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 98 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 84 LAVVLQRRDWENPG 97 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 98 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 84 LAVVLQRRDWENPG 97 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 82.6 bits (195), Expect = 3e-16 Identities = 40/61 (65%), Positives = 45/61 (73%), Gaps = 7/61 (11%) Frame = +3 Query: 45 IHWPSFYNIVT-------GKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGE 203 IH+ S+YN + + VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGE Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGE 1523 Query: 204 W 206 W Sbjct: 1524 W 1524 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 98 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 143 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 84 LAVVLQRRDWENPG 97 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 65 LAVVLQRRDWENPG 78 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 38 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 24 LAVVLQRRDWENPG 37 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 122 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 108 LAVVLQRRDWENPG 121 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 38 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 24 LAVVLQRRDWENPG 37 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 57 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 102 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 43 LAVVLQRRDWENPG 56 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 90 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 135 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 76 LAVVLQRRDWENPG 89 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 81 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 67 LAVVLQRRDWENPG 80 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 105 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 150 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 91 LAVVLQRRDWENPG 104 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 41 LAVVLQRRDWENPG 54 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 148 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 193 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 134 LAVVLQRRDWENPG 147 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 196 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 241 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 182 LAVVLQRRDWENPG 195 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 73 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 118 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 59 LAVVLQRRDWENPG 72 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 49 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 94 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 160 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 205 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 146 LAVVLQRRDWENPG 159 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 117 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 58 LAVVLQRRDWENPG 71 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 130 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 175 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 116 LAVVLQRRDWENPG 129 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 37 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 82 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 23 LAVVLQRRDWENPG 36 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 666 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 711 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 652 LAVVLQRRDWENPG 665 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 53 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 39 LAVVLQRRDWENPG 52 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 175 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 220 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 161 LAVVLQRRDWENPG 174 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 36 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 81 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 22 LAVVLQRRDWENPG 35 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 70 LAVVLQRRDWENPG 83 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 85 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 130 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 71 LAVVLQRRDWENPG 84 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 93 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 79 LAVVLQRRDWENPG 92 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 199 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 244 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 185 LAVVLQRRDWENPG 198 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 458 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 503 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 444 LAVVLQRRDWENPG 457 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 87 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 73 LAVVLQRRDWENPG 86 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 280 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 325 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 266 LAVVLQRRDWENPG 279 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 34 LAVVLQRRDWENPG 47 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 84 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 129 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 70 LAVVLQRRDWENPG 83 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 118 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 104 LAVVLQRRDWENPG 117 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 77 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 63 LAVVLQRRDWENPG 76 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 87 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 73 LAVVLQRRDWENPG 86 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 87 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 132 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 73 LAVVLQRRDWENPG 86 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 88 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 133 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 74 LAVVLQRRDWENPG 87 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 59 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 104 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 97 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 83 LAVVLQRRDWENPG 96 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 190 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 235 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 176 LAVVLQRRDWENPG 189 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 45 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 90 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 31 LAVVLQRRDWENPG 44 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 97 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 142 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 83 LAVVLQRRDWENPG 96 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 63 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 49 LAVVLQRRDWENPG 62 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 82 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 127 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 68 LAVVLQRRDWENPG 81 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 57 LAVVLQRRDWENPG 70 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 69 LAVVLQRRDWENPG 82 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 38 LAVVLQRRDWENPG 51 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 58 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 44 LAVVLQRRDWENPG 57 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 76 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 62 LAVVLQRRDWENPG 75 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 95 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 81 LAVVLQRRDWENPG 94 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 101 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 146 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 87 LAVVLQRRDWENPG 100 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 118 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 163 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 104 LAVVLQRRDWENPG 117 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 52 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 97 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 38 LAVVLQRRDWENPG 51 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 64 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 109 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 50 LAVVLQRRDWENPG 63 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 63 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 108 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 49 LAVVLQRRDWENPG 62 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 140 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 126 LAVVLQRRDWENPG 139 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 69 LAVVLQRRDWENPG 82 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 69 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 55 LAVVLQRRDWENPG 68 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 68 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 54 LAVVLQRRDWENPG 67 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 102 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 147 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 88 LAVVLQRRDWENPG 101 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 69 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 114 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 55 LAVVLQRRDWENPG 68 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 108 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 153 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 94 LAVVLQRRDWENPG 107 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 79 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 124 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 65 LAVVLQRRDWENPG 78 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 181 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 226 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 167 LAVVLQRRDWENPG 180 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 93 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 138 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 79 LAVVLQRRDWENPG 92 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 71 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 116 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 57 LAVVLQRRDWENPG 70 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 119 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 164 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 105 LAVVLQRRDWENPG 118 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 95 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 36 LAVVLQRRDWENPG 49 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 133 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 178 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 119 LAVVLQRRDWENPG 132 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 166 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 211 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 152 LAVVLQRRDWENPG 165 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 116 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 161 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 102 LAVVLQRRDWENPG 115 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 34 LAVVLQRRDWENPG 47 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 51 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 37 LAVVLQRRDWENPG 50 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 69 LAVVLQRRDWENPG 82 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 140 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 185 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 126 LAVVLQRRDWENPG 139 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 40 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 26 LAVVLQRRDWENPG 39 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 99 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 85 LAVVLQRRDWENPG 98 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 107 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 93 LAVVLQRRDWENPG 106 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 86 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 86 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 131 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 72 LAVVLQRRDWENPG 85 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 107 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 152 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 93 LAVVLQRRDWENPG 106 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 121 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 166 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 107 LAVVLQRRDWENPG 120 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 95 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 81 LAVVLQRRDWENPG 94 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 122 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 167 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 108 LAVVLQRRDWENPG 121 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 320 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 365 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 306 LAVVLQRRDWENPG 319 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 66 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 111 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 52 LAVVLQRRDWENPG 65 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 29 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 74 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 15 LAVVLQRRDWENPG 28 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 40 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 26 LAVVLQRRDWENPG 39 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 70 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 115 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 56 LAVVLQRRDWENPG 69 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 261 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 306 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 247 LAVVLQRRDWENPG 260 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 95 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 140 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 81 LAVVLQRRDWENPG 94 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 93 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 34 LAVVLQRRDWENPG 47 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 62 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 107 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 48 LAVVLQRRDWENPG 61 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 38 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 83 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 24 LAVVLQRRDWENPG 37 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 218 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 263 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 204 LAVVLQRRDWENPG 217 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 77 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 122 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 63 LAVVLQRRDWENPG 76 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 733 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 778 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 719 LAVVLQRRDWENPG 732 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 53 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 98 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 39 LAVVLQRRDWENPG 52 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 201 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 246 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 187 LAVVLQRRDWENPG 200 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 129 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 174 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 115 LAVVLQRRDWENPG 128 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 44 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 89 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 30 LAVVLQRRDWENPG 43 >SB_29747| Best HMM Match : Ank (HMM E-Value=0) Length = 416 Score = 82.6 bits (195), Expect = 3e-16 Identities = 43/76 (56%), Positives = 47/76 (61%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNILLKFALNFCKSAHFL 272 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW L +A + Sbjct: 305 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWDAPCSGAL--------SAAGVV 356 Query: 273 TNRPKSAKSLINQKNR 320 R K L+N K R Sbjct: 357 VTRSNGGKGLLNTKER 372 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 291 LAVVLQRRDWENPG 304 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 34 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 79 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 20 LAVVLQRRDWENPG 33 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = +3 Query: 18 IRPIVSRXTIHWPSFYNIVTGKTLAVTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCN 197 +RP+VSR TIHW SFYN+VTGKTLA+ L L P + +EEARTD PSQQLR+ N Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 198 GEW 206 GEW Sbjct: 93 GEW 95 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 99 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 144 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 85 LAVVLQRRDWENPG 98 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 46 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 91 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 32 LAVVLQRRDWENPG 45 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 123 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 168 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 109 LAVVLQRRDWENPG 122 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 82.6 bits (195), Expect = 3e-16 Identities = 38/49 (77%), Positives = 38/49 (77%) Frame = -1 Query: 189 CATVGKGXRCGPLRYYASWRKGDVLQGD*VG*RPGFSQSRCCKTTASEL 43 CATVGKG RCGPLRYYASWRKGD G PGFSQSR CKTTASEL Sbjct: 31 CATVGKGDRCGPLRYYASWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 35 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 21 LAVVLQRRDWENPG 34 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 51 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 96 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 37 LAVVLQRRDWENPG 50 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 74 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 119 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 60 LAVVLQRRDWENPG 73 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 35 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 80 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 21 LAVVLQRRDWENPG 34 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 41 LAVVLQRRDWENPG 54 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 81 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 126 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 67 LAVVLQRRDWENPG 80 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 58 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 103 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 44 LAVVLQRRDWENPG 57 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 76 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 121 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 62 LAVVLQRRDWENPG 75 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 135 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 180 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 121 LAVVLQRRDWENPG 134 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 83 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 128 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 69 LAVVLQRRDWENPG 82 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 378 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 423 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 364 LAVVLQRRDWENPG 377 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 100 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 41 LAVVLQRRDWENPG 54 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 68 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 113 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 54 LAVVLQRRDWENPG 67 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 82.6 bits (195), Expect = 3e-16 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIVXVNIL 230 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ +L Sbjct: 451 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLL 496 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 437 LAVVLQRRDWENPG 450 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 29 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 69 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 30 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 16 LAVVLQRRDWENPG 29 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 43 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 83 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 29 LAVVLQRRDWENPG 42 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 32 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 18 LAVVLQRRDWENPG 31 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 30 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 16 LAVVLQRRDWENPG 29 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 30 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 16 LAVVLQRRDWENPG 29 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 34 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 20 LAVVLQRRDWENPG 33 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 33 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 19 LAVVLQRRDWENPG 32 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 51 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 91 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 37 LAVVLQRRDWENPG 50 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 146 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 186 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 132 LAVVLQRRDWENPG 145 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 35 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 21 LAVVLQRRDWENPG 34 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 30 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 16 LAVVLQRRDWENPG 29 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 47 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 33 LAVVLQRRDWENPG 46 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 160 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 200 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 146 LAVVLQRRDWENPG 159 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 1204 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 1244 Score = 74.9 bits (176), Expect = 7e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 205 HSPLQVRNCWEGXSVRASSLLRQLAKGGCAARRLSW 98 HSP ++RNCWEG SVRASSLLRQLAKGGCAARRLSW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 1190 LAVVLQRRDWENPG 1203 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 91 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 131 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 77 LAVVLQRRDWENPG 90 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 45 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 31 LAVVLQRRDWENPG 44 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 82.2 bits (194), Expect = 5e-16 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEW 206 VTQLNRLAAHPPFASWRNSEEARTD PSQQLRT NGEW Sbjct: 44 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEW 81 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 30 LAVVLQRRDWENPG 43 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 30 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 16 LAVVLQRRDWENPG 29 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 34 LAVVLQRRDWENPG 47 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 50 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 90 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 36 LAVVLQRRDWENPG 49 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 54 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 94 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 40 LAVVLQRRDWENPG 53 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 35 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 75 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 21 LAVVLQRRDWENPG 34 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 30 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 16 LAVVLQRRDWENPG 29 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 31 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 17 LAVVLQRRDWENPG 30 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 45 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 85 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 31 LAVVLQRRDWENPG 44 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 184 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 224 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 170 LAVVLQRRDWENPG 183 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 33 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 73 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 19 LAVVLQRRDWENPG 32 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 61 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 101 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 47 LAVVLQRRDWENPG 60 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 46 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 86 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 32 LAVVLQRRDWENPG 45 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 58 LAVVLQRRDWENPG 71 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 31 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 17 LAVVLQRRDWENPG 30 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 74 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 114 Score = 62.5 bits (145), Expect = 4e-10 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 108 RLAAHPPFASWRNSEEARTDXPSQQLRTCNGE 203 +++AHPPFASWRNSEEARTD PSQQLR+ NGE Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 60 LAVVLQRRDWENPG 73 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 34 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 20 LAVVLQRRDWENPG 33 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 75 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 115 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 61 LAVVLQRRDWENPG 74 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 31 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 17 LAVVLQRRDWENPG 30 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 39 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 79 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 34 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 20 LAVVLQRRDWENPG 33 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 87 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 127 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 73 LAVVLQRRDWENPG 86 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 156 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 196 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 142 LAVVLQRRDWENPG 155 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 34 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 20 LAVVLQRRDWENPG 33 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 30 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 70 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 16 LAVVLQRRDWENPG 29 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 205 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 245 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 191 LAVVLQRRDWENPG 204 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 55 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 95 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 41 LAVVLQRRDWENPG 54 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 36 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 76 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 22 LAVVLQRRDWENPG 35 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 34 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 20 LAVVLQRRDWENPG 33 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 57 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 97 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 43 LAVVLQRRDWENPG 56 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 32 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 72 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 18 LAVVLQRRDWENPG 31 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 72 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 112 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 58 LAVVLQRRDWENPG 71 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 34 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 74 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 20 LAVVLQRRDWENPG 33 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 76 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 116 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 62 LAVVLQRRDWENPG 75 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 56 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 96 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 42 LAVVLQRRDWENPG 55 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 31 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 71 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 17 LAVVLQRRDWENPG 30 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 47 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 87 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 33 LAVVLQRRDWENPG 46 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 48 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 88 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 34 LAVVLQRRDWENPG 47 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 60 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 100 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 46 LAVVLQRRDWENPG 59 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 40 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 80 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 26 LAVVLQRRDWENPG 39 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 109 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 149 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWEN G Sbjct: 95 LAVVLQRRDWENTG 108 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 82.2 bits (194), Expect = 5e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 93 VTQLNRLAAHPPFASWRNSEEARTDXPSQQLRTCNGEWQIV 215 VTQLNRLAAHPPFASWRNSEEARTD PSQQLR+ NGEW+++ Sbjct: 69 VTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 109 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 50 LAVVLQHRDWENPG 91 LAVVLQ RDWENPG Sbjct: 55 LAVVLQRRDWENPG 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,087,608 Number of Sequences: 59808 Number of extensions: 403230 Number of successful extensions: 7535 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7507 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -