BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0172.Seq (923 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1186 + 34816774-34817055,34817216-34817334,34818139-348186... 29 5.2 03_05_0041 - 20169308-20169317,20169485-20170491 29 6.9 >02_05_1186 + 34816774-34817055,34817216-34817334,34818139-34818664, 34818760-34818977,34819639-34819966 Length = 490 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 232 LYYCWIWQAGSIIAHRIATETNY-TYIVLEAGSKGHGLLDIP 354 L CW+ G I++ ++ TNY Y+V + +G LD P Sbjct: 141 LSVCWLEIHGKILSKMLSRNTNYAAYLVYRIADRSYG-LDFP 181 >03_05_0041 - 20169308-20169317,20169485-20170491 Length = 338 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 332 VMVYWIFLFLVPFYINRFMIG-TMKHHHRKMLAGA 433 +++ +FL +PF I R M G T+ H R +AGA Sbjct: 186 ILLVILFLVSIPFLIKRIMDGETLFHDRRVWMAGA 220 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,301,531 Number of Sequences: 37544 Number of extensions: 448287 Number of successful extensions: 841 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2635816500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -