BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0172.Seq (923 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66494-4|CAA91263.1| 599|Caenorhabditis elegans Hypothetical pr... 42 8e-04 >Z66494-4|CAA91263.1| 599|Caenorhabditis elegans Hypothetical protein C34C6.4 protein. Length = 599 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 4/88 (4%) Frame = +1 Query: 256 AGSIIAHRIATETNYTYIVLEAGSKGHGL---LDIPVLSPF-LHKSVYDWNYETSPQENA 423 AG ++A+R+ + + +++EAG H + +P + L Y+W+Y T+ Q+N Sbjct: 48 AGCVLANRLTEDPSNRVLLIEAGPVDHKWDWRIHMPAALMYNLCSDTYNWHYHTTAQKN- 106 Query: 424 CWGMVDHKCRLPQGKIVGGSSKLNNMVH 507 + + P+G++ GGSS LN M + Sbjct: 107 ---LGNRVFYWPRGRVWGGSSTLNAMCY 131 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,073,083 Number of Sequences: 27780 Number of extensions: 422514 Number of successful extensions: 994 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 958 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 993 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2370744068 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -