BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0172.Seq (923 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 42 8e-06 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 9.0 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 41.9 bits (94), Expect = 8e-06 Identities = 23/84 (27%), Positives = 42/84 (50%) Frame = +1 Query: 256 AGSIIAHRIATETNYTYIVLEAGSKGHGLLDIPVLSPFLHKSVYDWNYETSPQENACWGM 435 A +++A R++ +N+ ++LEAG +IP DW Y T+ + +AC Sbjct: 79 ARAVVAGRLSEVSNWKVLLLEAGPDEPAGAEIPSNLQLYLGGDLDWKYYTTNESHACLS- 137 Query: 436 VDHKCRLPQGKIVGGSSKLNNMVH 507 C P+GK +GG++ + M + Sbjct: 138 TGGSCYWPRGKNLGGTTLHHGMAY 161 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 9.0 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 454 VCIYGQPCPSKHFPV 410 VC+ + CP +H PV Sbjct: 103 VCVCMRKCPRRHRPV 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 242,492 Number of Sequences: 438 Number of extensions: 5228 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30113811 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -