BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0165.Seq (853 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 23 3.1 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 23 4.1 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = +3 Query: 174 HNKLLIKFHIIYLNR-----IIFKHLLCEI*SIVVLIKKTKFISRSY 299 HN + +K +IY NR I+F H+ +++ + K + + Y Sbjct: 139 HNLIRLKNCVIYFNRIFGWNILFGHIFTVCRTLIYIDDNVKGLGKQY 185 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 851 FTAPSPPKNLIGVM 810 F AP PP+N GV+ Sbjct: 16 FKAPQPPENWTGVL 29 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,258 Number of Sequences: 336 Number of extensions: 4027 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -