BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0164.Seq (883 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 109 2e-24 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 104 1e-22 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-22 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 1e-21 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 1e-21 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 1e-21 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 100 1e-21 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 100 1e-21 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 100 2e-21 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 100 2e-21 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 99 4e-21 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 99 4e-21 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 99 4e-21 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 99 4e-21 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 99 4e-21 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 99 4e-21 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 99 4e-21 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 99 4e-21 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 99 4e-21 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 99 4e-21 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 99 4e-21 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 4e-21 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 99 4e-21 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 98 7e-21 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 98 9e-21 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 98 9e-21 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 97 1e-20 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 97 1e-20 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 97 1e-20 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 97 1e-20 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 97 1e-20 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 97 1e-20 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 97 1e-20 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 97 1e-20 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 97 1e-20 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 97 1e-20 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 97 1e-20 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 97 1e-20 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 97 1e-20 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 97 1e-20 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 97 1e-20 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 97 1e-20 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 97 1e-20 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 97 1e-20 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 97 1e-20 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 97 1e-20 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 97 1e-20 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 97 1e-20 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 97 1e-20 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 97 1e-20 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 97 1e-20 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 97 1e-20 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 97 1e-20 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 97 1e-20 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 97 1e-20 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 97 1e-20 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 97 1e-20 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 97 1e-20 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 97 1e-20 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 97 1e-20 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 97 1e-20 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 97 1e-20 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 97 1e-20 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 97 1e-20 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 97 1e-20 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 97 1e-20 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 97 1e-20 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 97 1e-20 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 97 1e-20 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 97 1e-20 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 97 1e-20 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 97 1e-20 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 97 1e-20 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 97 1e-20 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 97 1e-20 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 97 1e-20 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 97 1e-20 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 97 1e-20 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 2e-20 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 96 3e-20 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 96 3e-20 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 96 4e-20 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 4e-20 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 95 5e-20 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 95 5e-20 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 95 5e-20 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 95 5e-20 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 95 5e-20 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 95 5e-20 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 95 5e-20 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 95 5e-20 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 95 5e-20 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 95 5e-20 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 95 5e-20 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 95 5e-20 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 95 5e-20 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 95 5e-20 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 95 5e-20 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 95 5e-20 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 95 5e-20 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 95 5e-20 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 95 5e-20 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 95 5e-20 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 95 5e-20 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 95 5e-20 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 95 5e-20 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 95 5e-20 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 95 5e-20 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 95 5e-20 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 95 5e-20 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 95 5e-20 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 95 5e-20 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 95 5e-20 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 95 5e-20 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 95 5e-20 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 5e-20 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 95 5e-20 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 95 5e-20 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 109 bits (263), Expect = 2e-24 Identities = 52/58 (89%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = +2 Query: 359 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIXLPNS-AXLNGEW 529 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPI LP LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 104 bits (249), Expect = 1e-22 Identities = 49/66 (74%), Positives = 53/66 (80%), Gaps = 3/66 (4%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRMANCKR* 546 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ C + Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQN 112 Query: 547 YFVKIR 564 Y ++R Sbjct: 113 YTTRLR 118 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 102 bits (245), Expect = 3e-22 Identities = 50/70 (71%), Positives = 53/70 (75%) Frame = -3 Query: 578 NKNLTRILTKY*RLQFAIRHSXAHCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 399 NKN R ++ I +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQS Sbjct: 201 NKNSKRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQS 260 Query: 398 RRCKTTASEL 369 RRCKTTASEL Sbjct: 261 RRCKTTASEL 270 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 101 bits (241), Expect = 1e-21 Identities = 47/59 (79%), Positives = 49/59 (83%), Gaps = 3/59 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRMANCKR 543 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ C + Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDK 228 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 101 bits (241), Expect = 1e-21 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = -3 Query: 521 HSXAHCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 H +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 389 HRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 100 bits (240), Expect = 1e-21 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA 513 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQCA Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCA 74 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 100 bits (240), Expect = 1e-21 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA 513 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQCA Sbjct: 512 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCA 557 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 100 bits (240), Expect = 1e-21 Identities = 48/59 (81%), Positives = 49/59 (83%), Gaps = 3/59 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRMANCKR 543 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ KR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 100 bits (239), Expect = 2e-21 Identities = 48/62 (77%), Positives = 50/62 (80%), Gaps = 3/62 (4%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRMANCKR* 546 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ R Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRD 250 Query: 547 YF 552 Y+ Sbjct: 251 YY 252 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 100 bits (239), Expect = 2e-21 Identities = 46/52 (88%), Positives = 47/52 (90%) Frame = -3 Query: 524 RHSXAHCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 R +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 249 REKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 223 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 891 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 378 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 294 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 360 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 34 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 270 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 243 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 268 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 452 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 121 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 287 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 137 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 196 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 588 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 502 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 85 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 99.1 bits (236), Expect = 4e-21 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 369 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 186 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 98.3 bits (234), Expect = 7e-21 Identities = 46/52 (88%), Positives = 47/52 (90%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 354 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 11 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 95.5 bits (227), Expect = 5e-20 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQ 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQ 128 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 98.3 bits (234), Expect = 7e-21 Identities = 47/59 (79%), Positives = 49/59 (83%), Gaps = 3/59 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRMANCKR 543 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ +R Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRPQR 256 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 97.9 bits (233), Expect = 9e-21 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = -3 Query: 527 IRHSXAHCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 375 +R + +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 403 LRQALRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 97.9 bits (233), Expect = 9e-21 Identities = 46/58 (79%), Positives = 48/58 (82%), Gaps = 3/58 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRMANCK 540 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ + Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 62 [lacZ-alpha fragment, 54 aa] 115 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 25 [lacZ-alpha fragment, 54 aa] 78 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 49 [lacZ-alpha fragment, 54 aa] 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 28 [lacZ-alpha fragment, 54 aa] 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 29 [lacZ-alpha fragment, 54 aa] 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 833 [lacZ-alpha fragment, 54 aa] 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 114 [lacZ-alpha fragment, 54 aa] 167 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 39 [lacZ-alpha fragment, 54 aa] 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 11 [lacZ-alpha fragment, 54 aa] 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 19 [lacZ-alpha fragment, 54 aa] 72 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 88 [lacZ-alpha fragment, 54 aa] 141 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 37 [lacZ-alpha fragment, 54 aa] 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 132 [lacZ-alpha fragment, 54 aa] 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 153 [lacZ-alpha fragment, 54 aa] 206 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 57 [lacZ-alpha fragment, 54 aa] 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 21 [lacZ-alpha fragment, 54 aa] 74 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 60 [lacZ-alpha fragment, 54 aa] 113 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 213 [lacZ-alpha fragment, 54 aa] 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 33 [lacZ-alpha fragment, 54 aa] 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 48 [lacZ-alpha fragment, 54 aa] 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 40 [lacZ-alpha fragment, 54 aa] 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 75 [lacZ-alpha fragment, 54 aa] 128 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 57 [lacZ-alpha fragment, 54 aa] 110 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 100 [lacZ-alpha fragment, 54 aa] 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 28 [lacZ-alpha fragment, 54 aa] 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 146 [lacZ-alpha fragment, 54 aa] 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 59 [lacZ-alpha fragment, 54 aa] 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 88 [lacZ-alpha fragment, 54 aa] 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 100 [lacZ-alpha fragment, 54 aa] 153 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 1190 [lacZ-alpha fragment, 54 aa] 1243 Score = 62.1 bits (144), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSW 423 +CWE RSVRASSLLRQLAKGGCAARRLSW Sbjct: 411 NCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 32 [lacZ-alpha fragment, 54 aa] 85 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 125 [lacZ-alpha fragment, 54 aa] 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 77 [lacZ-alpha fragment, 54 aa] 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 31 [lacZ-alpha fragment, 54 aa] 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 36 [lacZ-alpha fragment, 54 aa] 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 96 [lacZ-alpha fragment, 54 aa] 149 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 61 [lacZ-alpha fragment, 54 aa] 114 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 84 [lacZ-alpha fragment, 54 aa] 137 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 40 [lacZ-alpha fragment, 54 aa] 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 84 [lacZ-alpha fragment, 54 aa] 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 84 [lacZ-alpha fragment, 54 aa] 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 21 [lacZ-alpha fragment, 54 aa] 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 65 [lacZ-alpha fragment, 54 aa] 118 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 24 [lacZ-alpha fragment, 54 aa] 77 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 108 [lacZ-alpha fragment, 54 aa] 161 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 24 [lacZ-alpha fragment, 54 aa] 77 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 43 [lacZ-alpha fragment, 54 aa] 96 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 76 [lacZ-alpha fragment, 54 aa] 129 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 67 [lacZ-alpha fragment, 54 aa] 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 91 [lacZ-alpha fragment, 54 aa] 144 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 41 [lacZ-alpha fragment, 54 aa] 94 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 1063 [lacZ-alpha fragment, 54 aa] 1116 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 31 [lacZ-alpha fragment, 54 aa] 84 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 134 [lacZ-alpha fragment, 54 aa] 187 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 182 [lacZ-alpha fragment, 54 aa] 235 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 59 [lacZ-alpha fragment, 54 aa] 112 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 19 [lacZ-alpha fragment, 54 aa] 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 146 [lacZ-alpha fragment, 54 aa] 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 116 [lacZ-alpha fragment, 54 aa] 169 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 23 [lacZ-alpha fragment, 54 aa] 76 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 652 [lacZ-alpha fragment, 54 aa] 705 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 39 [lacZ-alpha fragment, 54 aa] 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 161 [lacZ-alpha fragment, 54 aa] 214 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 47 [lacZ-alpha fragment, 54 aa] 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 32 [lacZ-alpha fragment, 54 aa] 85 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 70 [lacZ-alpha fragment, 54 aa] 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 60 [lacZ-alpha fragment, 54 aa] 113 Score = 51.2 bits (117), Expect = 1e-06 Identities = 21/25 (84%), Positives = 24/25 (96%) Frame = +1 Query: 433 RLAAHPPFASWRNSEEARTDRXSQQ 507 +++AHPPFASWRNSEEARTDR SQQ Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQ 38 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 71 [lacZ-alpha fragment, 54 aa] 124 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 79 [lacZ-alpha fragment, 54 aa] 132 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 185 [lacZ-alpha fragment, 54 aa] 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 444 [lacZ-alpha fragment, 54 aa] 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 266 [lacZ-alpha fragment, 54 aa] 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 61 [lacZ-alpha fragment, 54 aa] 114 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 70 [lacZ-alpha fragment, 54 aa] 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 104 [lacZ-alpha fragment, 54 aa] 157 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 63 [lacZ-alpha fragment, 54 aa] 116 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 74 [lacZ-alpha fragment, 54 aa] 127 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 83 [lacZ-alpha fragment, 54 aa] 136 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 176 [lacZ-alpha fragment, 54 aa] 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 31 [lacZ-alpha fragment, 54 aa] 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 83 [lacZ-alpha fragment, 54 aa] 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 49 [lacZ-alpha fragment, 54 aa] 102 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 142 [lacZ-alpha fragment, 54 aa] 195 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 68 [lacZ-alpha fragment, 54 aa] 121 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 57 [lacZ-alpha fragment, 54 aa] 110 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 69 [lacZ-alpha fragment, 54 aa] 122 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 38 [lacZ-alpha fragment, 54 aa] 91 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 44 [lacZ-alpha fragment, 54 aa] 97 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWRL 92 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 62 [lacZ-alpha fragment, 54 aa] 115 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 81 [lacZ-alpha fragment, 54 aa] 134 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 87 [lacZ-alpha fragment, 54 aa] 140 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 104 [lacZ-alpha fragment, 54 aa] 157 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 38 [lacZ-alpha fragment, 54 aa] 91 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 50 [lacZ-alpha fragment, 54 aa] 103 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 49 [lacZ-alpha fragment, 54 aa] 102 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 41 [lacZ-alpha fragment, 54 aa] 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 126 [lacZ-alpha fragment, 54 aa] 179 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 43 [lacZ-alpha fragment, 54 aa] 96 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 69 [lacZ-alpha fragment, 54 aa] 122 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 55 [lacZ-alpha fragment, 54 aa] 108 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 54 [lacZ-alpha fragment, 54 aa] 107 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 88 [lacZ-alpha fragment, 54 aa] 141 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 55 [lacZ-alpha fragment, 54 aa] 108 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 94 [lacZ-alpha fragment, 54 aa] 147 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 65 [lacZ-alpha fragment, 54 aa] 118 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 97.5 bits (232), Expect = 1e-20 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = -3 Query: 521 HSXAHCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 375 H +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 93 HRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 167 [lacZ-alpha fragment, 54 aa] 220 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 62 [lacZ-alpha fragment, 54 aa] 115 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 42 [lacZ-alpha fragment, 54 aa] 95 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 33 [lacZ-alpha fragment, 54 aa] 86 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 79 [lacZ-alpha fragment, 54 aa] 132 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 57 [lacZ-alpha fragment, 54 aa] 110 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 105 [lacZ-alpha fragment, 54 aa] 158 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 46 [lacZ-alpha fragment, 54 aa] 99 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 36 [lacZ-alpha fragment, 54 aa] 89 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 119 [lacZ-alpha fragment, 54 aa] 172 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 152 [lacZ-alpha fragment, 54 aa] 205 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 102 [lacZ-alpha fragment, 54 aa] 155 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 26 [lacZ-alpha fragment, 54 aa] 79 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 55 [lacZ-alpha fragment, 54 aa] 108 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 37 [lacZ-alpha fragment, 54 aa] 90 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 97.5 bits (232), Expect = 1e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 509 HCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 372 +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 533 NCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 56 [lacZ-alpha fragment, 54 aa] 109 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 156 [lacZ-alpha fragment, 54 aa] 209 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 27 [lacZ-alpha fragment, 54 aa] 80 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 69 [lacZ-alpha fragment, 54 aa] 122 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 126 [lacZ-alpha fragment, 54 aa] 179 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 89 [lacZ-alpha fragment, 54 aa] 142 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 26 [lacZ-alpha fragment, 54 aa] 79 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 71 [lacZ-alpha fragment, 54 aa] 124 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 85 [lacZ-alpha fragment, 54 aa] 138 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 44 [lacZ-alpha fragment, 54 aa] 97 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 93 [lacZ-alpha fragment, 54 aa] 146 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 145 [lacZ-alpha fragment, 54 aa] 198 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 791 [lacZ-alpha fragment, 54 aa] 844 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 72 [lacZ-alpha fragment, 54 aa] 125 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 93 [lacZ-alpha fragment, 54 aa] 146 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 55 [lacZ-alpha fragment, 54 aa] 108 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 107 [lacZ-alpha fragment, 54 aa] 160 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 81 [lacZ-alpha fragment, 54 aa] 134 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 108 [lacZ-alpha fragment, 54 aa] 161 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 306 [lacZ-alpha fragment, 54 aa] 359 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 30 [lacZ-alpha fragment, 54 aa] 83 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 52 [lacZ-alpha fragment, 54 aa] 105 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 15 [lacZ-alpha fragment, 54 aa] 68 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 26 [lacZ-alpha fragment, 54 aa] 79 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 56 [lacZ-alpha fragment, 54 aa] 109 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 247 [lacZ-alpha fragment, 54 aa] 300 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 81 [lacZ-alpha fragment, 54 aa] 134 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 48 [lacZ-alpha fragment, 54 aa] 101 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 24 [lacZ-alpha fragment, 54 aa] 77 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 204 [lacZ-alpha fragment, 54 aa] 257 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 63 [lacZ-alpha fragment, 54 aa] 116 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 97.5 bits (232), Expect = 1e-20 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -3 Query: 524 RHSXAHCWEXRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 375 R++ +CWE RSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 110 RNTLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 159 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 35 [lacZ-alpha fragment, 54 aa] 88 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 719 [lacZ-alpha fragment, 54 aa] 772 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 39 [lacZ-alpha fragment, 54 aa] 92 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 37 [lacZ-alpha fragment, 54 aa] 90 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 97.5 bits (232), Expect = 1e-20 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +2 Query: 374 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIXLPNS 508 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPI LPNS Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNS 106 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 187 [lacZ-alpha fragment, 54 aa] 240 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 97.5 bits (232), Expect = 1e-20 Identities = 46/54 (85%), Positives = 47/54 (87%), Gaps = 3/54 (5%) Frame = +1 Query: 376 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRXSQQCA---XEWRM 528 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR SQQ EWR+ Sbjct: 115 [lacZ-alpha fragment, 54 aa] 168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,046,008 Number of Sequences: 59808 Number of extensions: 559382 Number of successful extensions: 4979 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4964 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -