BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0160.Seq (819 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 4e-17 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 5e-17 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 83 2e-16 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 78 7e-15 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 78 7e-15 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 78 7e-15 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 73 2e-13 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 71 1e-12 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 70 3e-12 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 69 3e-12 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 68 1e-11 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 68 1e-11 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 68 1e-11 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 68 1e-11 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 68 1e-11 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 68 1e-11 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 68 1e-11 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 68 1e-11 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 68 1e-11 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 68 1e-11 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 68 1e-11 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 68 1e-11 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 68 1e-11 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 68 1e-11 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 67 1e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 67 2e-11 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 66 2e-11 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 66 2e-11 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 66 2e-11 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 66 2e-11 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 66 2e-11 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 66 2e-11 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 66 2e-11 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 66 2e-11 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 66 2e-11 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 66 2e-11 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 66 2e-11 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 66 2e-11 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 66 2e-11 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 66 2e-11 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 66 2e-11 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 66 2e-11 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 66 2e-11 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 66 2e-11 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 66 2e-11 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 66 2e-11 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 66 2e-11 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 66 2e-11 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 66 2e-11 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 66 2e-11 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 66 2e-11 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 66 2e-11 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 66 2e-11 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 66 2e-11 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 66 2e-11 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 66 2e-11 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 66 2e-11 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 66 2e-11 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 66 2e-11 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 66 2e-11 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 66 2e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 66 2e-11 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 66 2e-11 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 66 2e-11 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 66 2e-11 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 66 2e-11 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 66 2e-11 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 66 2e-11 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 66 2e-11 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 66 2e-11 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 66 2e-11 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 66 2e-11 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 66 2e-11 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 66 2e-11 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 66 2e-11 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 66 2e-11 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 66 2e-11 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 66 2e-11 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 66 2e-11 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 66 3e-11 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 66 3e-11 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 66 3e-11 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 66 3e-11 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 66 3e-11 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 66 3e-11 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 66 3e-11 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 66 3e-11 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 66 3e-11 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 66 3e-11 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 66 3e-11 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 66 3e-11 SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 66 3e-11 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 66 3e-11 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 66 3e-11 SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 66 3e-11 SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 66 3e-11 SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_25902| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_3997| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 64 1e-10 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_16615| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 64 1e-10 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 64 1e-10 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 64 1e-10 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 85.8 bits (203), Expect = 4e-17 Identities = 42/63 (66%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +2 Query: 131 IRPIVSRITIHWPSFYNVVTGKTLALPXLIALQHIPXSPAGE*RRGPHRS-PFPTVAXLN 307 +RP+VSRITIHW SFYNVVTGKTLALP LIALQHIP SPAG P + LN Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 308 GEW 316 GEW Sbjct: 93 GEW 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 85.4 bits (202), Expect = 5e-17 Identities = 42/61 (68%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = +2 Query: 137 PIVSRITIHWPSFYNVVTGKTLALPXLIALQHIPXSPAGE*RRGPHRS-PFPTVAXLNGE 313 P +SRITIHWPSFYNVVTGKTLALP LIALQHIP SPAG R P + LNGE Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 314 W 316 W Sbjct: 137 W 137 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 83.4 bits (197), Expect = 2e-16 Identities = 41/58 (70%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = +2 Query: 146 SRITIHWPSFYNVVTGKTLALPXLIALQHIPXSPAGE*RRGPHRSPFP-TVAXLNGEW 316 SRITIHWPSFYNVVTGKTLALP LIALQHIP SPAG + P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 82.2 bits (194), Expect = 5e-16 Identities = 39/59 (66%), Positives = 39/59 (66%) Frame = -3 Query: 304 QXRNCWEGRSVRASSLFASWRXGDVLQGD*XG*RQCFPSHDVVKRRPVNCNTTHYRANW 128 Q RNCWEGRSVRASSL G FPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 80.6 bits (190), Expect = 1e-15 Identities = 40/58 (68%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +2 Query: 146 SRITIHWPSFYNVVTGKTLALPXLIALQHIPXSPAG-E*RRGPHRSPFPTVAXLNGEW 316 SRITIHWPSFYNVVTGKTLALP LIALQHIP SPAG P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 78.2 bits (184), Expect = 7e-15 Identities = 41/67 (61%), Positives = 43/67 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXGDVLQGD*XG*RQCFPSHDVVKRRPVNCNT 149 A + PF + RNCWEGRSVRASSL G FPSHDVVKRRPVNCNT Sbjct: 587 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAA---RRLSWGFPSHDVVKRRPVNCNT 641 Query: 148 THYRANW 128 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 78.2 bits (184), Expect = 7e-15 Identities = 41/67 (61%), Positives = 43/67 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXGDVLQGD*XG*RQCFPSHDVVKRRPVNCNT 149 A + PF + RNCWEGRSVRASSL G FPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAA---RRLSWGFPSHDVVKRRPVNCNT 84 Query: 148 THYRANW 128 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 78.2 bits (184), Expect = 7e-15 Identities = 41/67 (61%), Positives = 43/67 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXGDVLQGD*XG*RQCFPSHDVVKRRPVNCNT 149 A + PF + RNCWEGRSVRASSL G FPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAA---RRLSWGFPSHDVVKRRPVNCNT 84 Query: 148 THYRANW 128 THYRANW Sbjct: 85 THYRANW 91 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 74.9 bits (176), Expect = 7e-14 Identities = 38/62 (61%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = +2 Query: 161 HWPSFYNVVTGKTLALPXLIALQHIPXSPAGE*RRGPHRS-PFPTVAXLNGEWQIVSVNI 337 HWPSFYNVVTGKTLALP LIALQHIP SPAG P + LNGEW+++ N Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLMR-NF 63 Query: 338 LL 343 LL Sbjct: 64 LL 65 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 73.3 bits (172), Expect = 2e-13 Identities = 37/66 (56%), Positives = 42/66 (63%), Gaps = 3/66 (4%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRMANCKR* 333 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ C + Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQN 112 Query: 334 YFVKIR 351 Y ++R Sbjct: 113 YTTRLR 118 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 72.5 bits (170), Expect = 4e-13 Identities = 39/56 (69%), Positives = 42/56 (75%), Gaps = 4/56 (7%) Frame = -3 Query: 283 GRSVRASSLFA---SWRXGDVLQGD*X-G*RQCFPSHDVVKRRPVNCNTTHYRANW 128 GR++ A LFA + GDVLQGD G RQ FPSHDVVKRRPVNCNTTHYRANW Sbjct: 48 GRAIGAG-LFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 299 AQLLGRAIGAGLFAIRQLAKXG 234 AQLLGRAIGAGLFAI + G Sbjct: 44 AQLLGRAIGAGLFAITPAGEKG 65 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 71.3 bits (167), Expect = 9e-13 Identities = 38/60 (63%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = +2 Query: 146 SRITIHWPSFYNVVTGKTLALPXLIALQHIPXSPAGE*RRGPHR---SPFPTVAXLNGEW 316 SRITIHWPSFYNVVTGKTLALP LIALQHIP P R P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP--PFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 70.5 bits (165), Expect = 1e-12 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = +1 Query: 175 LQRRDWENTGVTQXNRLAAHPXFASWRIAKRPAPIALPNSCAXEWRM 315 LQRRDWEN GVTQ NRLAAHP FASWR ++RP P EWRM Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRM 394 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 70.5 bits (165), Expect = 1e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTPVFSQSRRCKTTASEL Sbjct: 7 GRSVRASSL-LRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 70.5 bits (165), Expect = 1e-12 Identities = 41/86 (47%), Positives = 46/86 (53%), Gaps = 3/86 (3%) Frame = +1 Query: 67 SICAIRFKKSFSKV*XGGPVXXXXXXXXXXXXLAVVLQRRDWENTGVTQXNRLAAHPXFA 246 +IC RF S + G P+ LAVVLQRRDWEN GVTQ NRLAAHP FA Sbjct: 55 AICVQRFDDSLNSAIHGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFA 112 Query: 247 SWR---IAKRPAPIALPNSCAXEWRM 315 SWR A+ P S EWR+ Sbjct: 113 SWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 70.1 bits (164), Expect = 2e-12 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRMANCKR 330 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ C + Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDK 228 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 69.7 bits (163), Expect = 3e-12 Identities = 36/59 (61%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRMANCKR 330 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ KR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 69.3 bits (162), Expect = 3e-12 Identities = 36/62 (58%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRMANCKR* 333 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ R Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRD 250 Query: 334 YF 339 Y+ Sbjct: 251 YY 252 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 68.9 bits (161), Expect = 5e-12 Identities = 35/54 (64%), Positives = 37/54 (68%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWENTGVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 148 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 227 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 214 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 242 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 895 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -3 Query: 304 QXRNCWEGRSVRASSLFASWRXG 236 Q RNCWEGRSVRASSL G Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKG 910 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 7 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 382 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 369 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 397 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 231 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 226 RNCWEGRSVRASSLLRQLAKG 246 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 298 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 285 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 313 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 364 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 359 RNCWEGRSVRASSLLRQLAKG 379 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 56 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/35 (51%), Positives = 21/35 (60%) Frame = -3 Query: 340 QNINAYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 +N A + PF + RNC EGRSVRASSL G Sbjct: 39 KNQGASHSPFRL--RNCGEGRSVRASSLLRQLAKG 71 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 38 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 25 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 53 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 274 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 269 RNCWEGRSVRASSLLRQLAKG 289 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 258 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 253 RNCWEGRSVRASSLLRQLAKG 273 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 247 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -3 Query: 307 IQXRNCWEGRSVRASSLFASWRXG 236 I+ RNCWEGRSVRASSL G Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKG 262 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 272 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 259 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 287 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 456 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/34 (55%), Positives = 22/34 (64%) Frame = -3 Query: 337 NINAYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 N+ A + PF + RNCWEGRSVRASSL G Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKG 471 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 125 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 120 RNCWEGRSVRASSLLRQLAKG 140 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 291 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 278 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 306 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 141 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 128 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 156 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 200 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 195 RNCWEGRSVRASSLLRQLAKG 215 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 592 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 579 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 607 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 228 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 35.5 bits (78), Expect = 0.052 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -3 Query: 352 REF*QNINAYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 + F N + + + RNCWEGRSVRASSL G Sbjct: 205 KRFQGNSQSSKYCISAKLRNCWEGRSVRASSLLRQLAKG 243 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 506 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 493 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 521 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 89 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 35.5 bits (78), Expect = 0.052 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 319 LPFAIQX-RNCWEGRSVRASSLFASWRXG 236 +P A+ RNCWEGRSVRASSL G Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKG 104 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 397 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 392 RNCWEGRSVRASSLLRQLAKG 412 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL 156 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASEL Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = -3 Query: 334 INAYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 + A + PF + RNCWEGRSVRASSL G Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKG 205 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 67.3 bits (157), Expect = 1e-11 Identities = 35/59 (59%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRMANCKR 330 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ +R Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRPQR 256 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 67.3 bits (157), Expect = 1e-11 Identities = 35/58 (60%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +2 Query: 146 SRITIHWPSFYNVVTGKTLALPXLIALQ-HIPXSPAGE*RRGPHRSPFPTVAXLNGEW 316 SRITIHWPSFYNVVTGKTLALP LIALQ H P + P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTASEL*YDSL 141 GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTASE D L Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 63.7 bits (148), Expect = 2e-10 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR 255 LAVVLQRRDWEN GVTQ NRLAAHP FASWR Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR 115 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +3 Query: 237 PFRQLANSEEARTDRPSQQLR 299 PF NSEEARTDRPSQQLR Sbjct: 110 PFASWRNSEEARTDRPSQQLR 130 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 66.9 bits (156), Expect = 2e-11 Identities = 38/54 (70%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -2 Query: 320 FAIRHSXAQLL-GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTAS 162 FAI+ AQLL GR++ A +RQLAK GCAARRL WVTP FSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLLEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 31.5 bits (68), Expect = 0.85 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 325 YNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 + PFAIQ EGRSVRASSL G Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSLLRQLAKG 37 >SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.9 bits (156), Expect = 2e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXWVTPVFSQSRRCKTTAS 162 GR++ A +RQLAK GCAARRL WVTPVFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPVFSQSRRCKTTAS 48 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +3 Query: 237 PFRQLANSEEARTDRPSQQLR 299 PF NSEEARTDRPSQQLR Sbjct: 65 PFASWRNSEEARTDRPSQQLR 85 Score = 35.1 bits (77), Expect = 0.069 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 298 RNCWEGRSVRASSLFASWRXG 236 RNCWEGRSVRASSL G Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 66.9 bits (156), Expect = 2e-11 Identities = 34/58 (58%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRMANCK 327 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ + Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRAR 586 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 66.9 bits (156), Expect = 2e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 161 HWPSFYNVVTGKTLALPXLIALQHIPXSPAG 253 HWPSFYNVVTGKTLALP LIALQHIP SPAG Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 92 Score = 35.5 bits (78), Expect = 0.052 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 IAKRPAPIALPNSCA 300 IAKRPAPIALPNSCA Sbjct: 94 IAKRPAPIALPNSCA 108 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 66.9 bits (156), Expect = 2e-11 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 161 HWPSFYNVVTGKTLALPXLIALQHIPXSPAG 253 HWPSFYNVVTGKTLALP LIALQHIP SPAG Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 87 Score = 35.5 bits (78), Expect = 0.052 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 256 IAKRPAPIALPNSCA 300 IAKRPAPIALPNSCA Sbjct: 89 IAKRPAPIALPNSCA 103 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 35.9 bits (79), Expect = 0.039 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 Query: 328 AYNLPFAIQXRNCWEGRSVRASSLFASWRXG 236 A + PF + RNCWEGRSVRASSL G Sbjct: 402 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 430 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 287 GRAIGAGLFAIRQLAKXGCAARRLXW 210 GR++ A +RQLAK GCAARRL W Sbjct: 415 GRSVRASSL-LRQLAKGGCAARRLSW 439 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = +3 Query: 237 PFRQLANSEEARTDRPSQQLR 299 PF NSEEARTDRPSQQLR Sbjct: 20 PFASWRNSEEARTDRPSQQLR 40 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 66.5 bits (155), Expect = 2e-11 Identities = 31/45 (68%), Positives = 32/45 (71%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWRIAKRPAPIALPNSC 297 LAVVLQRRDWEN GVTQ NRLAAHP FASW P + L SC Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWLENLSPLTVNLTGSC 186 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/54 (62%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Frame = +1 Query: 163 LAVVLQRRDWENTGVTQXNRLAAHPXFASWR---IAKRPAPIALPNSCAXEWRM 315 LAVVLQRRDWEN GVTQ NRLAAHP FASWR A+ P S EWR+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,796,346 Number of Sequences: 59808 Number of extensions: 423353 Number of successful extensions: 8727 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8389 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -