BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0158.Seq (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16H5.10c |prp43||ATP-dependent RNA helicase Prp43|Schizosacc... 29 0.63 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 27 3.3 >SPBC16H5.10c |prp43||ATP-dependent RNA helicase Prp43|Schizosaccharomyces pombe|chr 2|||Manual Length = 735 Score = 29.5 bits (63), Expect = 0.63 Identities = 18/66 (27%), Positives = 35/66 (53%) Frame = +2 Query: 314 AVXELPLSQSPDKHGFYTALHRGGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIAL 493 A+ EL D +G T L R + +P+ P ++ + I P FY + + L+L L+++ Sbjct: 476 ALEELNYLNCLDDNGDLTPLGRKASEFPLDPNLAVMLIRSPEFY--CSNEVLSLTALLSV 533 Query: 494 QHIPLR 511 ++ +R Sbjct: 534 PNVFVR 539 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 27.1 bits (57), Expect = 3.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 457 WENPGVTQLNRLAAHPPSPAGVIAKRPAPIALPNS 561 W N + L+ AA PP P + K P A P S Sbjct: 1868 WVNDDGSDLSNQAAPPPPPPMALPKAGPPSAAPTS 1902 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,219,608 Number of Sequences: 5004 Number of extensions: 61663 Number of successful extensions: 118 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -