BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0158.Seq (847 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 7e-21 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 94 1e-19 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 94 1e-19 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 94 1e-19 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 78 1e-14 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 69 4e-12 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 66 3e-11 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 66 3e-11 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 66 3e-11 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 66 3e-11 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 66 3e-11 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 66 3e-11 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 66 3e-11 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 66 3e-11 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 66 3e-11 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 66 3e-11 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 66 3e-11 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 66 3e-11 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 66 3e-11 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 66 3e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 65 6e-11 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 8e-11 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 64 1e-10 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 64 1e-10 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 64 1e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 63 2e-10 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 63 3e-10 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 62 4e-10 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 62 4e-10 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 62 4e-10 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 62 4e-10 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 62 4e-10 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 62 4e-10 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 62 4e-10 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 62 4e-10 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 62 4e-10 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 62 4e-10 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 62 4e-10 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 62 4e-10 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 62 4e-10 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 62 4e-10 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 62 4e-10 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 62 4e-10 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 62 4e-10 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 62 4e-10 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 62 4e-10 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 62 4e-10 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 62 4e-10 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 62 4e-10 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 62 4e-10 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 62 4e-10 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 62 4e-10 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 62 4e-10 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 62 4e-10 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 62 4e-10 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 62 4e-10 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 62 4e-10 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 62 4e-10 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 62 4e-10 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 62 4e-10 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 62 4e-10 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 62 4e-10 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 62 4e-10 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 62 4e-10 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 62 4e-10 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 62 4e-10 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 62 4e-10 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 62 4e-10 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 62 4e-10 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 62 4e-10 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 62 4e-10 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 62 4e-10 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 62 4e-10 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 62 4e-10 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 62 4e-10 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 62 4e-10 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 62 4e-10 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 62 4e-10 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 62 4e-10 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 62 4e-10 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 62 4e-10 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 62 4e-10 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 62 4e-10 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 62 4e-10 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 62 4e-10 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 62 4e-10 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 62 4e-10 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 62 4e-10 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 62 4e-10 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 62 4e-10 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 62 4e-10 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 62 4e-10 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 62 4e-10 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 62 4e-10 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 62 4e-10 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 62 5e-10 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 62 5e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 7e-10 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 7e-10 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 62 7e-10 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 61 1e-09 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 61 1e-09 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 61 1e-09 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 61 1e-09 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 61 1e-09 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 61 1e-09 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 61 1e-09 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 61 1e-09 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 61 1e-09 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 61 1e-09 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 61 1e-09 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 61 1e-09 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 61 1e-09 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 61 1e-09 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 61 1e-09 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 61 1e-09 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 61 1e-09 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 61 1e-09 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 61 1e-09 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 61 1e-09 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 61 1e-09 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 61 1e-09 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 61 1e-09 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 61 1e-09 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 61 1e-09 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 61 1e-09 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 61 1e-09 SB_17253| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 61 1e-09 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 98.3 bits (234), Expect = 7e-21 Identities = 46/59 (77%), Positives = 46/59 (77%) Frame = -1 Query: 571 QXRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 395 Q RNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 94.3 bits (224), Expect = 1e-19 Identities = 48/67 (71%), Positives = 50/67 (74%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNT 416 A + PF + RNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNT Sbjct: 587 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 641 Query: 415 THYRANW 395 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 94.3 bits (224), Expect = 1e-19 Identities = 48/67 (71%), Positives = 50/67 (74%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNT 416 A + PF + RNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 415 THYRANW 395 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 94.3 bits (224), Expect = 1e-19 Identities = 48/67 (71%), Positives = 50/67 (74%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPVNCNT 416 A + PF + RNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 415 THYRANW 395 THYRANW Sbjct: 85 THYRANW 91 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 80.2 bits (189), Expect = 2e-15 Identities = 40/63 (63%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = +2 Query: 398 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLRQLA**RRGPHRS-PFPTVAXLN 574 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPL P + LN Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 575 GEW 583 GEW Sbjct: 93 GEW 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 80.2 bits (189), Expect = 2e-15 Identities = 40/61 (65%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = +2 Query: 404 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLRQLA**RRGPHRS-PFPTVAXLNGE 580 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPL R P + LNGE Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 581 W 583 W Sbjct: 137 W 137 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 77.8 bits (183), Expect = 1e-14 Identities = 35/39 (89%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = -1 Query: 508 KGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 395 KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 566 AQLLGRAIGAGLFAITPAGEGG 501 AQLLGRAIGAGLFAITPAGE G Sbjct: 44 AQLLGRAIGAGLFAITPAGEKG 65 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 77.8 bits (183), Expect = 1e-14 Identities = 39/58 (67%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +2 Query: 413 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLRQLA**RRGPHRSPFP-TVAXLNGEW 583 SRITIHWPSFYNVVTGKTLALPNLIALQHIPL + P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 74.9 bits (176), Expect = 7e-14 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Frame = +2 Query: 413 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLRQLA**RRGPHRS-PFPTVAXLNGEW 583 SRITIHWPSFYNVVTGKTLALPNLIALQHIPL P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 72.1 bits (169), Expect = 5e-13 Identities = 37/58 (63%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +2 Query: 413 SRITIHWPSFYNVVTGKTLALPNLIALQHI-PLRQLA**RRGPHRSPFPTVAXLNGEW 583 SRITIHWPSFYNVVTGKTLALPNLIALQHI P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 70.5 bits (165), Expect = 2e-12 Identities = 37/56 (66%), Positives = 37/56 (66%) Frame = -3 Query: 596 RLQFAIRHSXAQLLGRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 RLQ A LLGRAIGAGLF ITPA E G ARRLSWV P FSQS RC AS Sbjct: 2 RLQAPFAIQAAHLLGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 69.3 bits (162), Expect = 4e-12 Identities = 35/66 (53%), Positives = 41/66 (62%), Gaps = 3/66 (4%) Frame = +1 Query: 430 LAVVLQRRDWENPGVTQLNRLAAHPPSPA---GVIAKRPAPIALPNSCAXEWRMANCKRX 600 LAVVLQRRDWENPGVTQLNRLAAHPP + A+ P S EWR+ C + Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCGQN 112 Query: 601 YFVKIR 618 Y ++R Sbjct: 113 YTTRLR 118 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 69.3 bits (162), Expect = 4e-12 Identities = 36/58 (62%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +2 Query: 413 SRITIHWPSFYNVVTGKTLALPNLIALQ-HIPLRQLA**RRGPHRSPFPTVAXLNGEW 583 SRITIHWPSFYNVVTGKTLALPNLIALQ H P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 68.9 bits (161), Expect = 5e-12 Identities = 35/58 (60%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +2 Query: 413 SRITIHWPSFYNVVTGKTLALPNLIALQHIPL-RQLA**RRGPHRSPFPTVAXLNGEW 583 SRITIHWPSFYNVVTGKTLALPNL L+HIPL P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 68.5 bits (160), Expect = 6e-12 Identities = 36/62 (58%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Frame = +2 Query: 428 HWPSFYNVVTGKTLALPNLIALQHIPLRQLA**RRGPHRS-PFPTVAXLNGEWQIVSVNI 604 HWPSFYNVVTGKTLALPNLIALQHIPL P + LNGEW+++ N Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWRLMR-NF 63 Query: 605 LL 610 LL Sbjct: 64 LL 65 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 66.9 bits (156), Expect = 2e-11 Identities = 35/58 (60%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Frame = +2 Query: 413 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLRQLA**RRGPHRSPFPTVAXLNGEW 583 SRITIHWPSFYNVVTGKTLALPNLIAL H P P + LNGEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 214 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 242 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 895 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -1 Query: 571 QXRNCWEGRSVRASSLLRQLAKG 503 Q RNCWEGRSVRASSLLRQLAKG Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKG 910 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 7 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 556 WEGRSVRASSLLRQLAKG 503 WEGRSVRASSLLRQLAKG Sbjct: 5 WEGRSVRASSLLRQLAKG 22 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 382 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 369 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 397 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 231 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 226 RNCWEGRSVRASSLLRQLAKG 246 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 298 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 285 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 313 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 364 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 359 RNCWEGRSVRASSLLRQLAKG 379 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 66.1 bits (154), Expect = 3e-11 Identities = 33/64 (51%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = +1 Query: 430 LAVVLQRRDWENPGVTQLNRLAAHPPSPA---GVIAKRPAPIALPNSCAXEWRMANCKRX 600 LAVVLQRRDWENPGVTQLNRLAAHPP + A+ P S EWR+ C + Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRCDKS 229 Query: 601 YFVK 612 + + Sbjct: 230 FIFR 233 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 56 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 44.8 bits (101), Expect = 9e-05 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -1 Query: 607 QNIXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 +N A + PF + RNC EGRSVRASSLLRQLAKG Sbjct: 39 KNQGASHSPFRL--RNCGEGRSVRASSLLRQLAKG 71 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 38 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 25 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 53 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 274 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 269 RNCWEGRSVRASSLLRQLAKG 289 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 258 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 253 RNCWEGRSVRASSLLRQLAKG 273 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 247 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -1 Query: 574 IQXRNCWEGRSVRASSLLRQLAKG 503 I+ RNCWEGRSVRASSLLRQLAKG Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKG 262 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 272 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 259 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 287 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 456 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 604 NIXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 N+ A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKG 471 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 125 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 120 RNCWEGRSVRASSLLRQLAKG 140 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 291 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 278 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 306 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 141 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 128 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 156 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 200 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 195 RNCWEGRSVRASSLLRQLAKG 215 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 592 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 579 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 607 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 228 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 223 RNCWEGRSVRASSLLRQLAKG 243 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 506 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 493 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 521 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 89 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 1/29 (3%) Frame = -1 Query: 586 LPFAIQX-RNCWEGRSVRASSLLRQLAKG 503 +P A+ RNCWEGRSVRASSLLRQLAKG Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKG 104 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 397 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 392 RNCWEGRSVRASSLLRQLAKG 412 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 66.1 bits (154), Expect = 3e-11 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 49.6 bits (113), Expect = 3e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 601 IXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 + A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKG 205 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 65.3 bits (152), Expect = 6e-11 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 408 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 430 LAVVLQRRDWENPGVTQLNRLAAHPP 507 LAVVLQRRDWENPGVTQLNRLAAHPP Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPP 110 Score = 49.2 bits (112), Expect = 4e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +3 Query: 504 PFASWRNSEEARTDRPSQQLR 566 PFASWRNSEEARTDRPSQQLR Sbjct: 110 PFASWRNSEEARTDRPSQQLR 130 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 30 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 65.3 bits (152), Expect = 6e-11 Identities = 36/54 (66%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -3 Query: 587 FAIRHSXAQLL-GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 FAI+ AQLL GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLLEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -1 Query: 592 YNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 + PFAIQ EGRSVRASSLLRQLAKG Sbjct: 8 HQAPFAIQAAQLLEGRSVRASSLLRQLAKG 37 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 65.3 bits (152), Expect = 6e-11 Identities = 34/62 (54%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = +1 Query: 430 LAVVLQRRDWENPGVTQLNRLAAHPPSPA---GVIAKRPAPIALPNSCAXEWRMANCKRX 600 LAVVLQRRDWENPGVTQLNRLAAHPP + A+ P S EWR+ R Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMRD 250 Query: 601 YF 606 Y+ Sbjct: 251 YY 252 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 64.9 bits (151), Expect = 8e-11 Identities = 36/52 (69%), Positives = 37/52 (71%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKGDVLQGD*VG*RQGFPSHDVVKRRPV 428 PF + RNCWEGRSVRASSLLRQLAKG GFPSHDVVKRRPV Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPV 67 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 64.9 bits (151), Expect = 8e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 509 EGGCAARRLSWVTPGFSQSRRCKTTASEL 423 +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 348 KGGCAARRLSWVTPGFSQSRRCKTTASEL 376 Score = 32.7 bits (71), Expect = 0.39 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 556 WEGRSVRASSLLRQLAKG 503 W+GRSVR SLLRQL KG Sbjct: 332 WKGRSVRTYSLLRQLVKG 349 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 64.9 bits (151), Expect = 8e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 509 EGGCAARRLSWVTPGFSQSRRCKTTASEL 423 +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 547 RSVRASSLLRQLAKG 503 RSVRASSLLRQLAKG Sbjct: 2 RSVRASSLLRQLAKG 16 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 64.9 bits (151), Expect = 8e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 509 EGGCAARRLSWVTPGFSQSRRCKTTASEL 423 +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 82 KGGCAARRLSWVTPGFSQSRRCKTTASEL 110 Score = 44.8 bits (101), Expect = 9e-05 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 Query: 552 KGDRCGPLRYYASWRRGMC 496 +GDRCGPLRYYASWR+G C Sbjct: 67 QGDRCGPLRYYASWRKGGC 85 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 64.9 bits (151), Expect = 8e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 509 EGGCAARRLSWVTPGFSQSRRCKTTASEL 423 +GGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 KGGCAARRLSWVTPGFSQSRRCKTTASEL 43 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 547 RSVRASSLLRQLAKG 503 RSVRASSLLRQLAKG Sbjct: 2 RSVRASSLLRQLAKG 16 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 64.5 bits (150), Expect = 1e-10 Identities = 34/73 (46%), Positives = 41/73 (56%) Frame = +1 Query: 442 LQRRDWENPGVTQLNRLAAHPPSPAGVIAKRPAPIALPNSCAXEWRMANCKRXYFVKIRV 621 LQRRDWENPGVTQLNRLAAHPP + ++RP P EWRM + YF+ + Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRSPFPTVAQPEWRMGLMR--YFLLTHL 405 Query: 622 KFLLNQLIF*PIG 660 IF +G Sbjct: 406 LIRPFMFIFFQVG 418 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 64.5 bits (150), Expect = 1e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASE 426 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 537 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 51.6 bits (118), Expect = 8e-07 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -1 Query: 607 QNIXAYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 +++ + P+ + RNCWEGRSVRASSLLRQLAKG Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKG 552 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 64.5 bits (150), Expect = 1e-10 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = +1 Query: 430 LAVVLQRRDWENPGVTQLNRLAAHPPSPAGVIAKRPAPIALPNSC 564 LAVVLQRRDWENPGVTQLNRLAAHPP + + P + L SC Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWLENLSPLTVNLTGSC 186 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 64.5 bits (150), Expect = 1e-10 Identities = 34/59 (57%), Positives = 37/59 (62%), Gaps = 3/59 (5%) Frame = +1 Query: 430 LAVVLQRRDWENPGVTQLNRLAAHPPSPA---GVIAKRPAPIALPNSCAXEWRMANCKR 597 LAVVLQRRDWENPGVTQLNRLAAHPP + A+ P S EWR+ KR Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKR 109 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 2e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 472 RQGFPSHDVVKRRPVNCNTTHYRANW 395 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 63.3 bits (147), Expect = 2e-10 Identities = 36/69 (52%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = +2 Query: 380 GGARYPIRPIVSRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLRQLA**RRGPHRSPFP 556 GGA PIRPIVSRITIHWP+FYN TGKTLA L L H P + P Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRNSQEARADRPSQ 93 Query: 557 TVAXLNGEW 583 + LNGEW Sbjct: 94 QLRSLNGEW 102 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 428 HWPSFYNVVTGKTLALPNLIALQHIPL 508 HWPSFYNVVTGKTLALPNLIALQHIPL Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPL 88 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 502 PPSPAGVIAKRPAPIALPNSCA 567 P SPAGVIAKRPAPIALPNSCA Sbjct: 87 PLSPAGVIAKRPAPIALPNSCA 108 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 428 HWPSFYNVVTGKTLALPNLIALQHIPL 508 HWPSFYNVVTGKTLALPNLIALQHIPL Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPL 83 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +1 Query: 502 PPSPAGVIAKRPAPIALPNSCA 567 P SPAGVIAKRPAPIALPNSCA Sbjct: 82 PLSPAGVIAKRPAPIALPNSCA 103 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 62.9 bits (146), Expect = 3e-10 Identities = 36/75 (48%), Positives = 41/75 (54%), Gaps = 3/75 (4%) Frame = +1 Query: 367 GVTSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPSPA---GVIAKRP 537 G+ RG P+ LAVVLQRRDWENPGVTQLNRLAAHPP + A+ Sbjct: 65 GIAGRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 122 Query: 538 APIALPNSCAXEWRM 582 P S EWR+ Sbjct: 123 RPSQQLRSLNGEWRL 137 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 62.9 bits (146), Expect = 3e-10 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 587 FAIRHSXAQLL-GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 FAI+ AQL GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -1 Query: 592 YNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 + PFAIQ WEGRSVRASSLLRQLAKG Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKG 37 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.9 bits (146), Expect = 3e-10 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 481 VG*RQGFPSHDVVKRRPVNCNTTHYRANW 395 +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 60.5 bits (140), Expect = 2e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -2 Query: 567 CATVGKGDRCGPLRYYASWRRGMCCKAIKLGNARVFP 457 CATVGKGDRCG + RGMCCKAIKLGNA+ FP Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 62.9 bits (146), Expect = 3e-10 Identities = 35/54 (64%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 587 FAIRHSXAQLL-GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 FAI+ AQL GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = -1 Query: 592 YNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 + PFAIQ WEGRSVRASSLLRQLAKG Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKG 37 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 62.9 bits (146), Expect = 3e-10 Identities = 39/81 (48%), Positives = 43/81 (53%), Gaps = 5/81 (6%) Frame = +1 Query: 355 RFLYGVTSRGGPVXXXXXXXXXXXXLA--VVLQRRDWENPGVTQLNRLAAHPPSPA---G 519 R L+GVT G V LA VVLQRRDWENPGVTQLNRLAAHPP + Sbjct: 42 RLLHGVTIAQGGVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 101 Query: 520 VIAKRPAPIALPNSCAXEWRM 582 A+ P S EWR+ Sbjct: 102 EEARTDRPSQQLRSLNGEWRL 122 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 483 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 474 PFRL--RNCWEGRSVRASSLLRQLAKG 498 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 153 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 148 RNCWEGRSVRASSLLRQLAKG 168 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 230 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 225 RNCWEGRSVRASSLLRQLAKG 245 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 374 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 369 RNCWEGRSVRASSLLRQLAKG 389 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 76 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 67 PFRL--RNCWEGRSVRASSLLRQLAKG 91 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 657 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 648 PFRL--RNCWEGRSVRASSLLRQLAKG 672 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 62.5 bits (145), Expect = 4e-10 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTASEL 423 GR++ A + +GGCAARRLSWVTP FSQSRRCKTTASEL Sbjct: 7 GRSVRASSL-LRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 556 WEGRSVRASSLLRQLAKG 503 WEGRSVRASSLLRQLAKG Sbjct: 5 WEGRSVRASSLLRQLAKG 22 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 566 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 557 PFRL--RNCWEGRSVRASSLLRQLAKG 581 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 413 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 408 RNCWEGRSVRASSLLRQLAKG 428 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 40 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 35 RNCWEGRSVRASSLLRQLAKG 55 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 796 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 791 RNCWEGRSVRASSLLRQLAKG 811 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 457 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 497 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 452 RNCWEGRSVRASSLLRQLAKG 472 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 76 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RN WEGRSVRASSLLRQLAKG Sbjct: 67 PFRL--RNYWEGRSVRASSLLRQLAKG 91 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 378 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 373 RNCWEGRSVRASSLLRQLAKG 393 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 1112 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 1107 RNCWEGRSVRASSLLRQLAKG 1127 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 303 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 574 IQXRNCWEGRSVRASSLLRQLAKG 503 I RNCWEGRSVRASSLLRQLAKG Sbjct: 295 ILLRNCWEGRSVRASSLLRQLAKG 318 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 117 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 112 RNCWEGRSVRASSLLRQLAKG 132 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 27 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 22 RNCWEGRSVRASSLLRQLAKG 42 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 43 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 Score = 48.8 bits (111), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 595 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKG 503 A + PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKG 58 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 493 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 488 RNCWEGRSVRASSLLRQLAKG 508 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 101 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 96 RNCWEGRSVRASSLLRQLAKG 116 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 61 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 Score = 48.8 bits (111), Expect = 5e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 574 IQXRNCWEGRSVRASSLLRQLAKG 503 ++ RNCWEGRSVRASSLLRQLAKG Sbjct: 53 LRLRNCWEGRSVRASSLLRQLAKG 76 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 63 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 P A + RNCWEGRSVRASSLLRQLAKG Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKG 78 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 57 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 97 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 52 RNCWEGRSVRASSLLRQLAKG 72 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 162 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 157 RNCWEGRSVRASSLLRQLAKG 177 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 22 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 13 PFRL--RNCWEGRSVRASSLLRQLAKG 37 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 199 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 190 PFRL--RNCWEGRSVRASSLLRQLAKG 214 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 135 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -1 Query: 574 IQXRNCWEGRSVRASSLLRQLAKG 503 I RNCWEGRSVRASSLLRQLAKG Sbjct: 127 ITLRNCWEGRSVRASSLLRQLAKG 150 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 106 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 Score = 49.6 bits (113), Expect = 3e-06 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = -1 Query: 586 LPFA--IQXRNCWEGRSVRASSLLRQLAKG 503 +PF ++ RNCWEGRSVRASSLLRQLAKG Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKG 121 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 62 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 57 RNCWEGRSVRASSLLRQLAKG 77 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 62.5 bits (145), Expect = 4e-10 Identities = 36/78 (46%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Frame = +1 Query: 358 FLYGVTSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPSPA---GVIA 528 F G+ + G P+ LAVVLQRRDWENPGVTQLNRLAAHPP + A Sbjct: 26 FAAGIVAEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 83 Query: 529 KRPAPIALPNSCAXEWRM 582 + P S EWR+ Sbjct: 84 RTDRPSQQLRSLNGEWRL 101 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 565 RNCWEGRSVRASSLLRQLAKG 503 RNCWEGRSVRASSLLRQLAKG Sbjct: 3 RNCWEGRSVRASSLLRQLAKG 23 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 554 GRAIGAGLFAITPAGEGGCAARRLSWVTPGFSQSRRCKTTAS 429 GR++ A + +GGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 48.4 bits (110), Expect = 7e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 583 PFAIQXRNCWEGRSVRASSLLRQLAKG 503 PF + RNCWEGRSVRASSLLRQLAKG Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKG 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,036,974 Number of Sequences: 59808 Number of extensions: 507946 Number of successful extensions: 8064 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7761 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2395401800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -