BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0158.Seq (847 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory pr... 24 6.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.8 >AJ000502-1|CAA04136.1| 299|Anopheles gambiae iron regulatory protein protein. Length = 299 Score = 23.8 bits (49), Expect = 6.7 Identities = 15/62 (24%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = +1 Query: 442 LQRRDWENPGVTQLNRLAAHPPSPAGVIAKRPAPIALPNSCAXEWRM---ANCKRXYFVK 612 + R + G+ L LA G+ + IA+P SC R+ +C + + V Sbjct: 213 IHRSNLVGMGIVPLQYLAGQNAESLGLTGQELFSIAIPESCKPHERIPVSTDCGKQFEVI 272 Query: 613 IR 618 +R Sbjct: 273 VR 274 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 8.8 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 496 AHPPSPAGVIAKRPAPIAL 552 A P SPAGV+ + P+A+ Sbjct: 1338 AAPSSPAGVLVAKVPPVAV 1356 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 832,660 Number of Sequences: 2352 Number of extensions: 16429 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -