BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0147.Seq (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30068| Best HMM Match : MoeA_C (HMM E-Value=2.9e-15) 34 0.099 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 33 0.30 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 29 2.8 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_7353| Best HMM Match : CAT (HMM E-Value=7.9e-08) 29 2.8 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 3.7 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 29 3.7 SB_58400| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 29 4.9 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 29 4.9 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 29 4.9 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 28 6.5 SB_4077| Best HMM Match : PDZ (HMM E-Value=3.5e-18) 28 6.5 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 28 6.5 SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 28 8.6 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 28 8.6 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 28 8.6 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 8.6 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 28 8.6 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 28 8.6 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 28 8.6 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 28 8.6 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 28 8.6 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) 28 8.6 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 28 8.6 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 28 8.6 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 8.6 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 28 8.6 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 28 8.6 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 28 8.6 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 28 8.6 >SB_30068| Best HMM Match : MoeA_C (HMM E-Value=2.9e-15) Length = 158 Score = 34.3 bits (75), Expect = 0.099 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +1 Query: 427 GNPVSATLTFYQLVQPLLAKLSGN 498 GNPVSA +TFY V P L KL+G+ Sbjct: 48 GNPVSAMVTFYLFVLPALRKLAGH 71 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +2 Query: 2 ELVDPPGCRN-LGIAEVPVIRKVRVALFSTGDELQLP 109 ELVDPPGCRN + VP + +V A T ++ +P Sbjct: 14 ELVDPPGCRNSIEDFNVPAVLQVTFAAGDTKKDIVIP 50 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -1 Query: 74 LHALYESPELRQSPDSCSPGDPLV 3 L A+ +PEL + +SCSPGDPLV Sbjct: 18 LPAVLGAPELLTASNSCSPGDPLV 41 >SB_50588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.53 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -3 Query: 87 VEKSATRTLRITGTSAIPRFLQPGGSTSS 1 +E + R L TS I FLQPGGSTSS Sbjct: 1 MEGGSRRLLMTKDTSGIIEFLQPGGSTSS 29 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 Query: 2 ELVDPPGCRNLGIAEVPVIRK 64 ELVDPPGCRN IA+ V+ K Sbjct: 14 ELVDPPGCRN-SIAQCRVLNK 33 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 56 SPELRQSPDSCSPGDPLV 3 S + +QS +SCSPGDPLV Sbjct: 16 SNQTKQSSNSCSPGDPLV 33 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 68 ALYESPELRQSPDSCSPGDPLV 3 A E P + +SCSPGDPLV Sbjct: 13 AAVERPSVASQSNSCSPGDPLV 34 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 56 SPELRQSPDSCSPGDPLV 3 SPE + +SCSPGDPLV Sbjct: 2 SPEKSRRSNSCSPGDPLV 19 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -1 Query: 74 LHALYESPELRQSPDSCSPGDPLV 3 L+ + E+ L+ + +SCSPGDPLV Sbjct: 14 LNKIKETRHLQAASNSCSPGDPLV 37 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 71 HALYESPELRQSPDSCSPGDPLV 3 H Y + + S +SCSPGDPLV Sbjct: 3 HMTYVTIHVLNSSNSCSPGDPLV 25 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -1 Query: 59 ESPELRQSPDSCSPGDPLV 3 + P + ++ +SCSPGDPLV Sbjct: 7 DRPHIHRASNSCSPGDPLV 25 >SB_7353| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 195 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -3 Query: 72 TRTLRITGTSAIPRFLQPGGSTSS 1 +R R T I FLQPGGSTSS Sbjct: 1 SRMFRTNKTQIIIEFLQPGGSTSS 24 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 59 ESPELRQSPDSCSPGDPLV 3 +SP R + +SCSPGDPLV Sbjct: 74 QSPLSRFTSNSCSPGDPLV 92 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -1 Query: 47 LRQSPDSCSPGDPLV 3 L++S +SCSPGDPLV Sbjct: 2 LKKSSNSCSPGDPLV 16 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 71 HALYESPELRQSPDSCSPGDPLV 3 H L E + +SCSPGDPLV Sbjct: 41 HTLMECDYVNDISNSCSPGDPLV 63 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -1 Query: 68 ALYESPELRQSPDSCSPGDPLV 3 ++Y +PE+ S +SCSPGDPLV Sbjct: 6 SVYLNPEVGTS-NSCSPGDPLV 26 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 2 ELVDPPGCRN--LGIAEVPVIRKVRVALFSTGDELQL 106 ELVDPPGCRN + + + + +A+ G L+L Sbjct: 31 ELVDPPGCRNSIMDSGLITIFLPIALAIVMAGMGLEL 67 >SB_58400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -2 Query: 64 FTNHRNFGNPQIPAARGIH 8 F + R+FG+ +IPAARGIH Sbjct: 23 FDHVRSFGSYRIPAARGIH 41 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 59 ESPELRQSPDSCSPGDPLV 3 +SP + + +SCSPGDPLV Sbjct: 17 DSPIVEKRSNSCSPGDPLV 35 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 56 SPELRQSPDSCSPGDPLV 3 SP R +SCSPGDPLV Sbjct: 21 SPRARLVSNSCSPGDPLV 38 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 56 SPELRQSPDSCSPGDPLV 3 S +R + +SCSPGDPLV Sbjct: 10 SANIRNTSNSCSPGDPLV 27 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 2 ELVDPPGCRNLGIAEVPVIRKVRVAL 79 ELVDPPGCRN IA + +V + L Sbjct: 90 ELVDPPGCRN-SIAGKNTVTQVGITL 114 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 80 KALHALYESPELRQSPDSCSPGDPLV 3 +++ L E+P +SCSPGDPLV Sbjct: 247 ESVEFLRENPVTEYISNSCSPGDPLV 272 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +2 Query: 2 ELVDPPGCRNLGIAE 46 ELVDPPGCRN I E Sbjct: 90 ELVDPPGCRNSMIYE 104 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/17 (76%), Positives = 14/17 (82%), Gaps = 3/17 (17%) Frame = +2 Query: 2 ELVDPPGCRN---LGIA 43 ELVDPPGCRN LG+A Sbjct: 14 ELVDPPGCRNSIVLGVA 30 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 2 ELVDPPGCRNLGIAEV 49 ELVDPPGCRN + +V Sbjct: 14 ELVDPPGCRNSIVTKV 29 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 2 ELVDPPGCRNLGIAEVPVIRKVRVALFSTGDELQ 103 ELVDPPGCRN I V + + GDE+Q Sbjct: 14 ELVDPPGCRN-SIQARSVDGFAKGYGYCAGDEIQ 46 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 Query: 2 ELVDPPGCRNLGIA 43 ELVDPPGCRN +A Sbjct: 14 ELVDPPGCRNSMVA 27 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -1 Query: 50 ELRQSPDSCSPGDPLV 3 +L +S +SCSPGDPLV Sbjct: 223 QLLESSNSCSPGDPLV 238 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -1 Query: 50 ELRQSPDSCSPGDPLV 3 +L+++ +SCSPGDPLV Sbjct: 9 QLKKASNSCSPGDPLV 24 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 65 LYESPELRQSPDSCSPGDPLV 3 L + E+ S +SCSPGDPLV Sbjct: 141 LRDLEEVANSSNSCSPGDPLV 161 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 56 SPELRQSPDSCSPGDPLV 3 S + Q+ +SCSPGDPLV Sbjct: 10 SANISQTSNSCSPGDPLV 27 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 72 TRTLRITGTSAIPRFLQPGGSTSS 1 +++ + G +I FLQPGGSTSS Sbjct: 25 SKSSTLVGMMSIIEFLQPGGSTSS 48 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -1 Query: 59 ESPELRQSPDSCSPGDPLV 3 +S ++ ++ +SCSPGDPLV Sbjct: 27 KSQDISKTSNSCSPGDPLV 45 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 Query: 47 LRQSPDSCSPGDPLV 3 +R++ +SCSPGDPLV Sbjct: 30 MRKTSNSCSPGDPLV 44 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 44 RQSPDSCSPGDPLV 3 R S +SCSPGDPLV Sbjct: 40 RSSSNSCSPGDPLV 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 Query: 2 ELVDPPGCRNLGIAEVPVIRKVRVALFSTG 91 ELVDPPGCRN I K R+++ G Sbjct: 71 ELVDPPGCRN-SITVFHCHTKFRMSIHQAG 99 >SB_4077| Best HMM Match : PDZ (HMM E-Value=3.5e-18) Length = 458 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -1 Query: 419 PQNQLLLSLPNANGLPGLIASFQKAISPSSSRIVLV*SASPTETPPEL 276 P NQL +LP PG IA +P + +V + + +P TP +L Sbjct: 354 PSNQLASTLPYLPSHPG-IAQQMNNTTPPTETVVPLQNTTPPSTPKDL 400 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 47 LRQSPDSCSPGDPLV 3 +R S +SCSPGDPLV Sbjct: 1 MRLSSNSCSPGDPLV 15 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 50 ELRQSPDSCSPGDPLV 3 ELR +SCSPGDPLV Sbjct: 74 ELRFLSNSCSPGDPLV 89 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -3 Query: 84 EKSATRTLRITGTSAIPRFLQPGGSTSS 1 E+S T R G FLQPGGSTSS Sbjct: 49 EESPKSTPRNCGNGQRIEFLQPGGSTSS 76 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 80 KALHALYESPELRQSPDSCSPGDPLV 3 +A H L+ L +SCSPGDPLV Sbjct: 24 RARHFLFVIEVLTGLSNSCSPGDPLV 49 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -3 Query: 75 ATRTLRITGTSAIPRFLQPGGSTSS 1 AT L + T FLQPGGSTSS Sbjct: 2 ATTLLTLQHTKPTIEFLQPGGSTSS 26 >SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) Length = 167 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 71 HALYESPELRQSPDSCSPGDPLV 3 + Y + +L + +SCSPGDPLV Sbjct: 32 YCAYWNRQLLNASNSCSPGDPLV 54 >SB_18197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1153 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 87 VEKSATRTLRITGTSAIPRFLQPGGSTSS 1 ++ + R I +S + FLQPGGSTSS Sbjct: 348 LKTAVDRRYAINPSSIVIEFLQPGGSTSS 376 >SB_6342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 41 QSPDSCSPGDPLV 3 QS +SCSPGDPLV Sbjct: 28 QSSNSCSPGDPLV 40 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 57 ITGTSAIPRFLQPGGSTSS 1 +TGT I FLQPGGSTSS Sbjct: 20 LTGTRLI-EFLQPGGSTSS 37 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 68 ALYESPELRQSPDSCSPGDPLV 3 +++ P + + +SCSPGDPLV Sbjct: 371 SVFPVPRVDRRSNSCSPGDPLV 392 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 LRQSPDSCSPGDPLV 3 LR +SCSPGDPLV Sbjct: 21 LRSRSNSCSPGDPLV 35 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 59 ESPELRQSPDSCSPGDPLV 3 + P ++ +SCSPGDPLV Sbjct: 55 DEPTAKKLSNSCSPGDPLV 73 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 34 ELVDPPGCRN 43 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 658 ELVDPPGCRN 667 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 47 LRQSPDSCSPGDPLV 3 L+ S +SCSPGDPLV Sbjct: 32 LKLSSNSCSPGDPLV 46 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 69 ELVDPPGCRN 78 >SB_48050| Best HMM Match : ChaB (HMM E-Value=7.7) Length = 138 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 63 LRITGTSAIPRFLQPGGSTSS 1 +R TG FLQPGGSTSS Sbjct: 7 MRRTGYRIFIEFLQPGGSTSS 27 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 31 ELVDPPGCRN 40 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_44433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 51 GTSAIPRFLQPGGSTSS 1 G A+ FLQPGGSTSS Sbjct: 5 GVDAMIEFLQPGGSTSS 21 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 51 ELVDPPGCRN 60 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = -1 Query: 56 SPELRQSP--DSCSPGDPLV 3 +PE+R S +SCSPGDPLV Sbjct: 11 NPEVRGSKPSNSCSPGDPLV 30 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 319 ELVDPPGCRN 328 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 50 ELRQSPDSCSPGDPLV 3 E+++ +SCSPGDPLV Sbjct: 24 EVQKGSNSCSPGDPLV 39 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = -1 Query: 62 YESPELRQSP---DSCSPGDPLV 3 Y P+ Q P +SCSPGDPLV Sbjct: 7 YFEPDSNQRPRESNSCSPGDPLV 29 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -1 Query: 92 HR*KKALHALYESPELRQSPDSCSPGDPLV 3 HR + ++ L + R++ +SCSPGDPLV Sbjct: 3 HRKTRKIYTLDHTE--RRASNSCSPGDPLV 30 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 53 PELRQSPDSCSPGDPLV 3 P + + +SCSPGDPLV Sbjct: 33 PSTQMASNSCSPGDPLV 49 >SB_11518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1144 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 484 LPAKAVPVDRRSASLKPGCPAGRRTS 407 LP +A+PV R A L+P CP G+ S Sbjct: 400 LPPQALPV--RLAGLEPACPPGKNLS 423 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 101 ELVDPPGCRN 110 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 PELRQSPDSCSPGDPLV 3 PE + +SCSPGDPLV Sbjct: 28 PENKALSNSCSPGDPLV 44 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 77 ELVDPPGCRN 86 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 ELRQSPDSCSPGDPLV 3 E R+ +SCSPGDPLV Sbjct: 67 ENRRGSNSCSPGDPLV 82 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 2 ELVDPPGCRN 31 ELVDPPGCRN Sbjct: 101 ELVDPPGCRN 110 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,486,424 Number of Sequences: 59808 Number of extensions: 477762 Number of successful extensions: 2762 Number of sequences better than 10.0: 108 Number of HSP's better than 10.0 without gapping: 2633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2762 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -