BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0146.Seq (614 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schiz... 27 2.8 SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 6.6 SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe... 25 8.7 >SPBC31F10.11c |cwf4|syf3|complexed with Cdc5 protein Cwf4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 674 Score = 26.6 bits (56), Expect = 2.8 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = -3 Query: 531 NILSLFKSITKXNHKMPRGKFTNHKGRNRKFTSPEELEEQRKHDEQKKKWRKE 373 ++ SL + K ++ G F + T+ ++ ++ RK E +KW++E Sbjct: 614 HVSSLMPQVVKKRRRLEDGSFEEYLDYLFPDTATDQGDKMRKMLELSRKWKEE 666 >SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 167 Score = 25.4 bits (53), Expect = 6.6 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -3 Query: 429 EELEEQRKHDEQKKKWRKEQ 370 + L+EQR+ EQKK+ +KE+ Sbjct: 138 QRLKEQREKKEQKKEQKKEK 157 >SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 738 Score = 25.0 bits (52), Expect = 8.7 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = -3 Query: 582 SLHHFXFNXNFKSLQXLNILSLFKSITKXNHKMPRGKFTNHKGRNRKFTSPEELEEQ 412 ++HH FN S+ + + ++ ++ T P N K RNR FT+P + E+ Sbjct: 421 AVHHDHFNST--SMDGVAVSNMDETGTSSAGSKP----FNRKSRNRSFTNPVGMTEE 471 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,457,636 Number of Sequences: 5004 Number of extensions: 19232 Number of successful extensions: 68 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -