BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0143.Seq (967 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 33 0.35 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 32 0.80 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 31 1.4 SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 30 2.4 SB_25902| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_3997| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 30 3.2 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 30 3.2 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 30 3.2 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 30 3.2 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 30 3.2 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 30 3.2 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 30 3.2 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 30 3.2 SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) 30 3.2 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 30 3.2 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 30 3.2 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 30 3.2 SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) 30 3.2 SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_42420| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 30 3.2 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 30 3.2 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 30 3.2 SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 30 3.2 SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 30 3.2 SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 29 4.3 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 29 4.3 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 29 4.3 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 29 4.3 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 4.3 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 29 4.3 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 29 4.3 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 29 4.3 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 29 4.3 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 29 4.3 SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 29 4.3 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 29 4.3 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 29 4.3 SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 29 4.3 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 29 5.6 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 5.6 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 29 5.6 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 5.6 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 29 5.6 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 5.6 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 29 5.6 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 29 5.6 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 29 5.6 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 29 5.6 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 29 5.6 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 29 5.6 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 29 5.6 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 29 5.6 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 5.6 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 29 5.6 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 29 5.6 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 29 5.6 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 29 5.6 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 29 5.6 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 29 5.6 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 29 5.6 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 29 5.6 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 29 5.6 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 29 5.6 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 29 5.6 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 29 5.6 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 29 5.6 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 29 5.6 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 5.6 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 29 5.6 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 29 5.6 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 29 5.6 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 29 5.6 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 29 5.6 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 29 5.6 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 29 5.6 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 29 5.6 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = -3 Query: 896 YPSWXKGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 Y SW KGG RRL WV P F S KTTA E+ Sbjct: 77 YASWRKGGCAARRLSWVTPGFSQSRRC-KTTASEL 110 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -3 Query: 896 YPSWXKGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 Y SW KG RRL WV P F S KTTA E+ Sbjct: 17 YASWRKGDVLQRRLSWVTPGFSQSRRC-KTTASEL 50 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/49 (42%), Positives = 24/49 (48%) Frame = -3 Query: 956 LPNXXGQFLERAXGAXLFANYPSWXKGGFXPRRLXWVNPRFFPSXDVFK 810 LP+ Q L RA GA LFA P+ KG L + FPS DV K Sbjct: 39 LPSQAAQLLGRAIGAGLFAITPAGEKGDVLQGDLKLGKRQGFPSHDVVK 87 >SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 473 TTKLIRINSSEKAEFPPESPGNHAFLRSQRVSVQVPAS*KLSPQRWNH 616 T+ L R+ +A FPPES F Q+V + PA + + WNH Sbjct: 960 TSVLGRVRGGARA-FPPESEQRGRFTVRQKVHIHAPAPARTTGSLWNH 1006 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ G+N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRD-GENTGVTQLNRLAAHPPF 55 >SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -3 Query: 65 YLGIAFGEVDGIDKLDIEF 9 Y G A EVDGIDKLDIEF Sbjct: 19 YRGPALDEVDGIDKLDIEF 37 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 66 SLAVVLQRRDW-ENPGVTQLNRLAAHPPF 93 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ G+N G TQ NRL +PPF Sbjct: 53 SLAVVLQRRD-GENTGVTQLNRLAAHPPF 80 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ G+N G TQ NRL +PPF Sbjct: 694 SLAVVLQRRD-GENTGVTQLNRLAAHPPF 721 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ G+N G TQ NRL +PPF Sbjct: 65 SLAVVLQRRD-GENTGVTQLNRLAAHPPF 92 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -2 Query: 939 AIFGKGXRCGPFR*LPQLXKRGIXPKAIXLGKPQVFP 829 A GKG RCG F P +RG+ KAI LG + FP Sbjct: 3 ATVGKGDRCGLFAITP-AGERGMCCKAIKLGNAKGFP 38 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/32 (56%), Positives = 21/32 (65%) Frame = +1 Query: 787 ITISLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 IT SLAVVL+ +N G TQ NRL +PPF Sbjct: 91 ITNSLAVVLQRRDW-ENTGVTQLNRLAAHPPF 121 >SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/31 (54%), Positives = 21/31 (67%) Frame = +1 Query: 790 TISLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 ++SLAVVL+ KN G TQ NRL +PPF Sbjct: 12 SLSLAVVLQRRDW-KNPGITQLNRLAAHPPF 41 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ G+N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRD-GENPGVTQLNRLAAHPPF 55 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -3 Query: 896 YPSWXKGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 Y SW KG RL WV P F S KTTA E+ Sbjct: 17 YASWRKGDVLQGRLSWVTPGFSQSRRC-KTTASEL 50 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 31.9 bits (69), Expect = 0.80 Identities = 20/50 (40%), Positives = 27/50 (54%) Frame = +1 Query: 733 IIIFQGGPGTNSXYK*VXITISLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 + I QGG G +++LAVVL+ +N G TQ NRL +PPF Sbjct: 47 VTIAQGGVGDPLESTCRHASLALAVVLQRRDW-ENPGVTQLNRLAAHPPF 95 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ KN G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-KNTGVTQLNRLAAHPPF 34 >SB_20754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRLG +PPF Sbjct: 7 SLAVVLQRRDW-ENPGVTQLNRLGAHPPF 34 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 881 FXNWGN*RKGPHRLPFPKIAPXNWAIG 961 F +W N + PHR PFP +A W +G Sbjct: 370 FASWRNSER-PHRSPFPTVAQPEWRMG 395 >SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPFXQLG 894 SL VVL+ +N G TQ NRLG +PPF G Sbjct: 7 SLGVVLQRRDW-ENPGVTQLNRLGGHPPFASWG 38 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ KN G TQ NRL +PPF Sbjct: 38 SLAVVLQRRDW-KNPGVTQLNRLAAHPPF 65 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPFXQLG 894 SLAVVL+ +N G TQ NRL +PPF G Sbjct: 66 SLAVVLQRRDW-ENPGVTQLNRLAAHPPFASWG 97 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEIVIXTHL*XELVPGPPWKIIMVPR 723 KGG RRL WV P F S KTTA + + PGP ++++ R Sbjct: 120 KGGCAARRLSWVTPGFSQSRRC-KTTASAKLACLQVDSRGSPGPKRNLLLLIR 171 >SB_25902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLRRRDW-ENTGVTQLNRLAAHPPF 34 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPFXQLG 894 SLAVVL+ +N G TQ NRL +PPF G Sbjct: 130 SLAVVLQRRDW-ENPGVTQLNRLAAHPPFASWG 161 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 829 GKNLGFTQXNRLGXNPPF 882 GKN G TQ NRL +PPF Sbjct: 17 GKNTGVTQLNRLAAHPPF 34 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFK 810 KGG RRL WV P FPS DV K Sbjct: 43 KGGCAARRLSWVTPG-FPSHDVVK 65 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPFXQLG 894 SLAVVL+ +N G TQ NRL +PPF G Sbjct: 51 SLAVVLQRRDW-ENPGVTQLNRLAAHPPFTSWG 82 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPFXQLG 894 SLAVVL+ +N G TQ NRL +PPF G Sbjct: 28 SLAVVLQRRDW-ENPGVTQLNRLAAHPPFASWG 59 >SB_3997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLRRRDW-ENTGVTQLNRLAAHPPF 34 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 829 GKNLGFTQXNRLGXNPPF 882 GKN G TQ NRL +PPF Sbjct: 17 GKNTGVTQLNRLAAHPPF 34 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 41 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 68 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 34 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 61 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 53 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 80 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 829 GKNLGFTQXNRLGXNPPF 882 GK LG TQ NRL +PPF Sbjct: 15 GKTLGVTQLNRLAAHPPF 32 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 55 SLAVVLQRRDW-ENTGVTQLNRLAVHPPF 82 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 89 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 116 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 41 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 68 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 50 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 77 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 51 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 78 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 150 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 177 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 27 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 54 >SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 56 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 83 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 45 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 72 >SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) Length = 499 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 407 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 434 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 94 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 121 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 36 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 63 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 34 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 61 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 514 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 541 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 66 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 93 >SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 35 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 62 >SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 55 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 82 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) Length = 148 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 56 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 83 >SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 55 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 82 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 48 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 75 >SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 35 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 62 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 54 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 81 >SB_27144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 83 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 110 >SB_26705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 65 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 92 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 70 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 97 >SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 1364 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 1391 >SB_22937| Best HMM Match : HD (HMM E-Value=1e-11) Length = 248 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 157 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 184 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_20052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 40 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 67 >SB_16432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 58 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 85 >SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_15017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 36 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 63 >SB_14731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 188 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 215 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 86 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 113 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 62 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 89 >SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_8712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 37 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 64 >SB_7643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 70 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 97 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 47 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 74 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 36 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 63 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 89 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 116 >SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_57755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_56140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 60 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 87 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 46 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 73 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 83 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 110 >SB_54538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 37 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 64 >SB_54475| Best HMM Match : Adeno_VII (HMM E-Value=9.4) Length = 165 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 73 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 100 >SB_53953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 40 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 67 >SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 64 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 91 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 87 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 114 >SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 135 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 162 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 52 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 79 >SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_48979| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 96 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 123 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 40 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 67 >SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 44 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 71 >SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 50 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 77 >SB_44528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 65 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 92 >SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 37 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 64 >SB_43165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 38 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 65 >SB_42745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 36 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 63 >SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_42420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 74 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 101 >SB_42105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 48 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 75 >SB_41672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 54 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 81 >SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 55 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 82 >SB_36440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 57 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 84 >SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 159 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 186 >SB_34794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 49 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 76 >SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) Length = 223 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 790 TISLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 +++LAVVL+ +N G TQ NRL +PPF Sbjct: 129 SLALAVVLQRRDW-ENTGVTQLNRLAAHPPF 158 >SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 56 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 83 >SB_32886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 36 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 63 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 117 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 144 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 104 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 131 >SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_29695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 57 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 84 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 69 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 96 >SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_27247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 46 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 73 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 34 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 61 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 56 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 83 >SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 43 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 70 >SB_25331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 50 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 77 >SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEIVIXTHL 774 KGG RRL WV P F S KTTA E+ + + + Sbjct: 242 KGGCAARRLSWVTPGFSQSRRC-KTTASELNVSSQV 276 >SB_22584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 39 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 66 >SB_21335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 44 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 71 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 42 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 69 >SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 43 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 70 >SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_19937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 41 SLAVVLQRRAW-ENTGVTQLNRLAAHPPF 68 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 122 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 149 >SB_19365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 33 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 60 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 612 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 639 >SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_18148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 46 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 73 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 104 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 131 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 84 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 111 >SB_17776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 37 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 64 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 137 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 164 >SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 47 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 74 >SB_15159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ KN G +Q NRL +PPF Sbjct: 51 SLAVVLQRRDW-KNTGVSQLNRLAVHPPF 78 >SB_14675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 46 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 73 >SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_13642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 47 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 74 >SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 191 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 218 >SB_12757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 36 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 63 >SB_11792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 7 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 34 >SB_11340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 67 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 94 >SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 135 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 162 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 40 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 67 >SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 90 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 117 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 45 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 72 >SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 53 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 80 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 68 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 95 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 46 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 73 >SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_6429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 51 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 78 >SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 37 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 64 >SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 34 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 61 >SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 48 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 75 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 37 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 64 >SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 28 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 55 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVVL+ +N G TQ NRL +PPF Sbjct: 52 SLAVVLQRRDW-ENTGVTQLNRLAAHPPF 79 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 29 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 241 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 269 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 961 ANCPIXGGNFWKGQXVRXFSLITPVGEKG 875 ++ P N W+G+ VR ITP GE+G Sbjct: 42 SHSPFRLRNCWEGRSVRGLFAITPAGERG 70 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 909 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 22 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 21 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 396 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 245 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 312 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 378 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 70 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 29 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 22 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 22 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 29 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 29 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 52 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 288 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 272 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 300 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 4.3 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +1 Query: 733 IIIFQGGPGTNSXYK*VXITISLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 +++ QG P ++ +++LAVVL+ +N G TQ NRL +PPF Sbjct: 36 VVVAQGDPLESTCRH---ASLALAVVLQRRDW-ENPGVTQLNRLAAHPPF 81 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 22 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 261 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 286 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 314 >SB_52624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 790 TISLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 +++LAVVL+ +N G TQ NRL +PPF Sbjct: 8 SLALAVVLRRRDW-ENPGVTQLNRLAAHPPF 37 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 470 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 498 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +1 Query: 796 SLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 SLAVV GK G TQ NRL +PPF Sbjct: 7 SLAVVYNV-VTGKTPGVTQLNRLAAHPPF 34 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 139 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 305 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 155 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 29 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 348 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 376 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 29 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 15 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 214 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 606 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 634 >SB_25066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1167 Score = 29.5 bits (63), Expect = 4.3 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +1 Query: 727 GTIIIFQGGP---GTNSXYK*VXITISLAVVLKTSXLGKNLGFTQXNRLGXNPPF 882 GT ++ + P +NS Y SLAVVL+ +N G TQ NRL +PPF Sbjct: 1078 GTHLVLERPPPRWSSNSPYSESYYN-SLAVVLQRRDW-ENPGVTQLNRLAAHPPF 1130 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -3 Query: 881 KGGFXPRRLXWVNPRFFPSXDVFKTTAXEI 792 KGG RRL WV P F S KTTA E+ Sbjct: 520 KGGCAARRLSWVTPGFSQSRRC-KTTASEL 548 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 829 GKNLGFTQXNRLGXNPPF 882 GKN G TQ NRL +PPF Sbjct: 17 GKNPGVTQLNRLAAHPPF 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,223,253 Number of Sequences: 59808 Number of extensions: 626617 Number of successful extensions: 4629 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4626 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2848211039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -