BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0142.Seq (961 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1218 - 31822915-31823141,31823418-31823832,31824090-318244... 31 1.8 09_01_0084 + 1202545-1202755,1202797-1203488 30 2.4 03_02_0726 + 10722759-10722857,10722969-10723058,10723141-107232... 30 2.4 01_06_1342 - 36438869-36439459,36439567-36439627,36440751-364411... 30 2.4 05_04_0166 + 18664609-18664890 30 3.1 06_03_0650 + 23157130-23157582,23157687-23157898,23157982-231581... 29 5.5 07_01_0566 + 4207894-4207974,4208090-4208144,4208671-4208759,420... 29 7.3 09_02_0406 - 8629287-8629304,8629384-8629865,8629977-8630291,863... 28 9.6 07_03_1487 - 26911652-26911989,26912114-26912201,26912559-26913470 28 9.6 06_03_1126 + 27805982-27806475,27806617-27807202 28 9.6 06_03_0324 - 19591267-19592097,19592266-19592583,19592827-19593108 28 9.6 03_01_0220 + 1745719-1745806,1745893-1746062,1746170-1746359,174... 28 9.6 02_05_0481 + 29361542-29361669,29362091-29362341,29362820-293630... 28 9.6 >04_04_1218 - 31822915-31823141,31823418-31823832,31824090-31824440, 31825391-31825549,31825965-31826093,31826257-31826460, 31827200-31827412,31827547-31830912,31830999-31831150, 31831912-31832407,31832646-31833456,31833537-31834728, 31834856-31834922 Length = 2593 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/86 (23%), Positives = 38/86 (44%), Gaps = 3/86 (3%) Frame = -1 Query: 577 EWSPELHRPAALHVLPWYPDDRSCGA-EAIQHF--MYGNEVSAAHVPVRLFGNQRKINKL 407 EW P ++ LH+L D +S ++H +YGN + + + NQ+ N Sbjct: 940 EWRPLMY---LLHILRSISDQKSSSLFSTLEHSSEVYGNSLCSVTRTIEEMSNQQPTNLP 996 Query: 406 DNLAIQQLYCCFFLAVGDIVAGIKQI 329 D++A LY D+++ ++ Sbjct: 997 DDVATSFLYSVICAPPDDVISSFPKL 1022 >09_01_0084 + 1202545-1202755,1202797-1203488 Length = 300 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 Query: 778 NRLAAHSPFRQLGVIAKKARTDWPSPTVAPLXWANGNL 891 +RLA P R V ARTD P VA L W G+L Sbjct: 111 SRLATGPPVRPRDVPCLLARTDDPPLAVAALSWLGGDL 148 >03_02_0726 + 10722759-10722857,10722969-10723058,10723141-10723245, 10723597-10723698,10724721-10724805,10725281-10725365, 10725473-10725517,10725685-10728672,10728839-10729055, 10729193-10729765 Length = 1462 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +1 Query: 586 NSKTPLKSYPLDIHNVQDHLKELADRYAIEG-GPGTPIRPIVSRITFTGRRLQRRDW 753 N +T + + LD ++++ + I+G GPGT I P + +G R QR+D+ Sbjct: 1099 NGRTAIMNSNLDANSMKHGANMFNEPNRIKGNGPGTLITPEPTCFILSGHRQQRKDY 1155 >01_06_1342 - 36438869-36439459,36439567-36439627,36440751-36441130, 36441955-36442761 Length = 612 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +1 Query: 505 RMIDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLD--IHNVQDHLKELADRYAIEG 678 R + + + E +GG A + I+ + L + P+D H+V DH ADR A + Sbjct: 189 RFLGPAEKLFEEICDVGGAASHVDRTISDEGLLDADPMDGVDHDVVDHDLGGADRAAADA 248 Query: 679 GP 684 GP Sbjct: 249 GP 250 >05_04_0166 + 18664609-18664890 Length = 93 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -3 Query: 869 RGATVGEGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKR 732 +G V EG R SWR+GE A W + Q RRC + Sbjct: 13 KGEVVREGAVARRRRP-AQSWRRGEAAVEERQWRCSAAHQRRRCDK 57 >06_03_0650 + 23157130-23157582,23157687-23157898,23157982-23158128, 23158214-23158347,23158442-23158551,23158711-23158817, 23159045-23159183,23159286-23159402,23159737-23159844, 23159927-23159998,23160108-23160230,23160336-23160495, 23160585-23160706,23160825-23160962,23161042-23161184, 23161305-23161367,23161567-23161630,23161709-23161844, 23162123-23162196,23162764-23162858,23162951-23162982, 23163104-23163276 Length = 973 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -1 Query: 541 HVLPWYPDDRSCGAEAIQHF--MYGNEVSAAHVPVRLFGNQRKINKL 407 H L + DD+ +++F MYG + H+P GNQ+K N L Sbjct: 385 HELIFPIDDQMNMKSVVEYFKEMYGFTIQHPHLPCLQVGNQKKANYL 431 >07_01_0566 + 4207894-4207974,4208090-4208144,4208671-4208759, 4209742-4209794,4209966-4210120,4210201-4210528, 4210618-4210730,4211394-4211538,4211951-4212259, 4212340-4212420,4212989-4213349 Length = 589 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +3 Query: 594 NPAEKLPAGHPQRSGSPERTG*PL--RNRGGARYPNSPYSES 713 +P P+ +P+R S R+ PL R RGG R P+ +S S Sbjct: 462 SPRASSPSRYPRRDRSRSRSRSPLRYRERGGYRRPSPRHSRS 503 >09_02_0406 - 8629287-8629304,8629384-8629865,8629977-8630291, 8630381-8630576 Length = 336 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 673 EGGPGTPIRPIVSRITFTGRRL 738 EG GTP ++ R TF GRR+ Sbjct: 198 EGSDGTPTSSVLRRATFRGRRM 219 >07_03_1487 - 26911652-26911989,26912114-26912201,26912559-26913470 Length = 445 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -3 Query: 824 AITPSWRKGECAARRLSWVNAGFXQSRRCKRRPVNVIRLTIGRI-GVPGP 678 A+ WR+G AA LSW F R + + +++ ++ GV P Sbjct: 177 AVAGVWREGRVAAEELSWDQTPFRADERARVKACGARVMSVEQVEGVRDP 226 >06_03_1126 + 27805982-27806475,27806617-27807202 Length = 359 Score = 28.3 bits (60), Expect = 9.6 Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +3 Query: 486 CWMASAPHDRSSGYHGRTCSAAGRCSSGDHSSYQQQNPAEKLPAGHPQRSGSPERTG*P- 662 C A+ P R Y GRT + ++ H++ QQ + G + +PE T Sbjct: 194 CSTAAYPASRCYYYAGRTAATNHSSAASSHAAAQQHRHHHRGGGGFCCFTSNPETTSNGH 253 Query: 663 --LRNRGGARYPNSP 701 R R G R SP Sbjct: 254 SFRRTRAGGRRARSP 268 >06_03_0324 - 19591267-19592097,19592266-19592583,19592827-19593108 Length = 476 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 673 EGGPGTPIRPIVSRITFTGRRL 738 EG GTP P++ R T GRR+ Sbjct: 342 EGSDGTPTSPVLRRATSRGRRM 363 >03_01_0220 + 1745719-1745806,1745893-1746062,1746170-1746359, 1748486-1748877,1749218-1749523 Length = 381 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 624 PQRSGSPERTG*PLRNRGGAR 686 P R GSP+ G P R RGG R Sbjct: 356 PARCGSPQYAGTPSRRRGGRR 376 >02_05_0481 + 29361542-29361669,29362091-29362341,29362820-29363002, 29363099-29363206,29363583-29363697,29363781-29364819, 29364904-29365014,29365268-29365326,29366601-29366763, 29367162-29367435,29367530-29367680,29367766-29367877, 29367978-29368143,29368261-29368331,29368474-29368565, 29368721-29368883,29369134-29369205,29369236-29369263, 29369519-29369910,29369991-29370106,29370201-29370498, 29370820-29371139,29371332-29371590,29371985-29372302, 29372423-29372527,29372648-29372776,29374001-29374381, 29374467-29374604,29374949-29375185,29375264-29375569 Length = 2094 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 696 SPYSESYYIHWASFTTS*LGKTCVNPT*SPCSTFPFSPA 812 SPY+ S Y+ WA +T + T V P + +T+ FSP+ Sbjct: 763 SPYATSMYLGWALSSTIAVLATGVIPIVAWFATYRFSPS 801 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,174,459 Number of Sequences: 37544 Number of extensions: 594061 Number of successful extensions: 1530 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1530 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2776393380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -