BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0142.Seq (961 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 60 3e-09 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 5e-09 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 57 2e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 57 2e-08 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 56 3e-08 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 55 1e-07 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 54 2e-07 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 53 4e-07 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 53 4e-07 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 52 5e-07 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 52 7e-07 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 52 9e-07 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 9e-07 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 51 1e-06 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) 51 2e-06 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 51 2e-06 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 51 2e-06 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 50 2e-06 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 50 2e-06 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 50 2e-06 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 50 2e-06 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 50 2e-06 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 50 2e-06 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 50 2e-06 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 50 2e-06 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 50 2e-06 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 50 2e-06 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 50 2e-06 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 50 2e-06 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 50 2e-06 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 50 2e-06 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 50 2e-06 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 50 2e-06 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 50 2e-06 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 50 2e-06 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 50 2e-06 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 50 2e-06 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 50 2e-06 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 50 2e-06 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 50 2e-06 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 50 2e-06 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 50 2e-06 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 50 2e-06 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 50 2e-06 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 50 2e-06 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 50 2e-06 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 50 2e-06 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 50 2e-06 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 50 2e-06 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 50 2e-06 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 50 2e-06 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 50 2e-06 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 50 2e-06 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 50 2e-06 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 50 2e-06 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 50 2e-06 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 50 2e-06 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 50 2e-06 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 50 2e-06 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 50 2e-06 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 50 2e-06 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 50 2e-06 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 50 2e-06 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 50 2e-06 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 50 2e-06 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 50 2e-06 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 50 2e-06 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 50 2e-06 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 50 2e-06 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 50 2e-06 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 50 2e-06 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 50 2e-06 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 50 2e-06 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 50 2e-06 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 50 2e-06 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 50 2e-06 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 50 2e-06 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 50 2e-06 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 50 2e-06 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 50 2e-06 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 50 2e-06 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 50 2e-06 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 50 2e-06 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 50 2e-06 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 50 2e-06 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 50 2e-06 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 50 2e-06 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 50 2e-06 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 50 2e-06 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 50 2e-06 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 50 2e-06 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 50 2e-06 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 50 2e-06 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 50 2e-06 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 50 2e-06 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 50 2e-06 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 50 2e-06 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 50 2e-06 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 50 2e-06 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 50 3e-06 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 50 3e-06 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 50 3e-06 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 50 4e-06 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 50 4e-06 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 50 4e-06 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 50 4e-06 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 50 4e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 50 4e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 50 4e-06 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 50 4e-06 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 50 4e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 50 4e-06 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 50 4e-06 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 50 4e-06 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 50 4e-06 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 50 4e-06 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 50 4e-06 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 50 4e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 60.5 bits (140), Expect = 2e-09 Identities = 31/57 (54%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = -2 Query: 852 GRPIGAGLLRYYPQLAKRGMCCKAIKLG*RRFXPV-TTL*TTPSECNTTHYRANWGT 685 GR IGAGL P +RGMCCKAIKLG P + P CNTTHYRANW + Sbjct: 14 GRAIGAGLFAITPA-GERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANWSS 69 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 60.1 bits (139), Expect = 3e-09 Identities = 34/55 (61%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +2 Query: 737 YNVVTGXNLR*PNLIALQHIPLFASWG**RRRPAPIGLPQQLRPXNGXM-AICKG 898 YNVVTG L PNLIALQHIPL + G +RPAPI LP+QLR NG A C G Sbjct: 12 YNVVTGKTLALPNLIALQHIPLSPA-GVIAKRPAPIALPKQLRSLNGEWDAPCSG 65 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/55 (34%), Positives = 22/55 (40%) Frame = +3 Query: 720 IHWASFTTS*LGKTCVNPT*SPCSTFPFSPAGGNSEEGPHRLAFPNSCAPXMGXW 884 IHW SF GKT P P SPAG ++ P +A P G W Sbjct: 6 IHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKR-PAPIALPKQLRSLNGEW 59 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 59.3 bits (137), Expect = 5e-09 Identities = 30/56 (53%), Positives = 33/56 (58%) Frame = -2 Query: 852 GRPIGAGLLRYYPQLAKRGMCCKAIKLG*RRFXPVTTL*TTPSECNTTHYRANWGT 685 GR IGAGL P +RGMCCKAIKL F + P CNTTHYRANW + Sbjct: 1847 GRAIGAGLFAITPA-GERGMCCKAIKLVTPVFPSHDVVKRRPVNCNTTHYRANWSS 1901 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPV 723 EG+SVRA ++ KG CAARRLSWV GF QSRRCKRRPV Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPV 723 EG+SVRA ++ KG CAARRLSWV GF QSRRCKRRPV Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPV 723 EG+SVRA ++ KG CAARRLSWV GF QSRRCKRRPV Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPV 723 EG+SVRA ++ KG CAARRLSWV GF QSRRCKRRPV Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPV 723 EG+SVRA ++ KG CAARRLSWV GF QSRRCKRRPV Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPV 723 EG+SVRA ++ KG CAARRLSWV GF QSRRCKRRPV Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 58.8 bits (136), Expect = 6e-09 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPV 723 EG+SVRA ++ KG CAARRLSWV GF QSRRCKRRPV Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 724 TGRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 TGRRLQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 62 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 724 TGRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 TGRRLQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 82 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 724 TGRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 TGRRLQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 72 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 724 TGRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 TGRRLQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 92 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 58.0 bits (134), Expect = 1e-08 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +1 Query: 724 TGRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 TGRRLQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 119 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 56.8 bits (131), Expect = 2e-08 Identities = 29/54 (53%), Positives = 32/54 (59%) Frame = +1 Query: 724 TGRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPLXWANG 885 TGR LQRRDW P +TQLNRLAAH PF + R+ P PTVA W G Sbjct: 344 TGRHLQRRDWENPGVTQLNRLAAHPPFASWRNSERPHRS--PFPTVAQPEWRMG 395 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 56.8 bits (131), Expect = 2e-08 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -2 Query: 852 GRPIGAGLLRYYPQLAKRGMCCKAIKLG*RRFXPV-TTL*TTPSECNTTHYRANWGT 685 GR IGAGL P +RGMCCK+IKL P + P CNTTHYRANW + Sbjct: 8 GRAIGAGLFAITPA-GERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRANWSS 63 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = -2 Query: 843 IGAGLLRYYPQLAKRGMCCKAIKLG*RRFXPV-TTL*TTPSECNTTHYRANWGT 685 IGAGL P +RGMCCKAIKLG P + P CNTTHYRANW + Sbjct: 3 IGAGLFAITPA-GERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANWSS 55 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/54 (57%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = -2 Query: 852 GRPIGAGLLRYYPQLAKRGMCCKAIKLG*RR-FXPVTTL*TTPSECNTTHYRAN 694 GR IGAGL P +RGMCCKAIKLG R F P CNTTHYRAN Sbjct: 45 GRSIGAGLFAITPA-GERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 54.8 bits (126), Expect = 1e-07 Identities = 33/73 (45%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = -3 Query: 896 PYKLPXAHXRGATVGEGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVN 720 P++ P A + A + EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 PHQAPFA-IQAAQLWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAK 64 Query: 719 VIRLTIGRIGVPG 681 + L + G PG Sbjct: 65 LACLQVDSRGSPG 77 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 54.4 bits (125), Expect = 1e-07 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -3 Query: 896 PYKLPXAHXRGATVGEGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 P++ P A + A + EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 PHQAPFA-IQAAQLWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 54.4 bits (125), Expect = 1e-07 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF G ++KARTD PS + L Sbjct: 135 LQRRDWENPGVTQLNRLAAHPPFASWG-NSEKARTDRPSQQLRSL 178 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 54.0 bits (124), Expect = 2e-07 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = +1 Query: 724 TGRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 TGRR RRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 87 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 54.0 bits (124), Expect = 2e-07 Identities = 30/54 (55%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = +1 Query: 694 IRPIVSRITFTGRRL-QRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPS 852 IRPIVSRIT +RRDW P + QLNRLAAH PF +++ARTD PS Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWR-SSEEARTDRPS 70 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 53.6 bits (123), Expect = 2e-07 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -3 Query: 896 PYKLPXAHXRGATVGEGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 P++ P A + A + EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 PHQAPFA-IQAAQLLEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/59 (50%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPGP 678 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PGP Sbjct: 105 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGP 162 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 53.2 bits (122), Expect = 3e-07 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = -3 Query: 812 SWRKGECAARRLSWVNAGFXQSRRCK 735 SWRKG CAARRLSWV GF QSRRCK Sbjct: 79 SWRKGGCAARRLSWVTPGFSQSRRCK 104 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.2 bits (122), Expect = 3e-07 Identities = 27/45 (60%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF G +KARTD PS + L Sbjct: 33 LQRRDWENPGVTQLNRLAAHPPFASWG-NNEKARTDRPSQQLRSL 76 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF G +++ARTD PS + L Sbjct: 71 LQRRDWENPGVTQLNRLAAHPPFASWG-NSEEARTDRPSQQLRSL 114 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 52.8 bits (121), Expect = 4e-07 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPGPP 675 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G P PP Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPP 87 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -3 Query: 854 GEGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 GEG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 54 GEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 92 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF G +++ARTD PS + L Sbjct: 56 LQRRDWENPGVTQLNRLAAHPPFTSWG-NSEEARTDRPSQQLRSL 99 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRP 726 EG+SVRA ++ KG CAARRLSWV GF QSRRCK P Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTP 47 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 52.0 bits (119), Expect = 7e-07 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 1/107 (0%) Frame = +1 Query: 553 GGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAIEGGPGTPIRPIVSRITFT-G 729 GG G + + + L + P D H V D +E+A + + G P+ + Sbjct: 12 GGQVSGNSYDHDYEFELGTLPGDFHFV-DWPREVAT-HVVYQEKGDPLESTCRHASLALA 69 Query: 730 RRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 70 VVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 115 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 52.0 bits (119), Expect = 7e-07 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA+ ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAY-SLFRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 52.0 bits (119), Expect = 7e-07 Identities = 35/98 (35%), Positives = 49/98 (50%), Gaps = 3/98 (3%) Frame = +1 Query: 586 NSKTPL--KSYPLDIHNVQDHLKELADRYAIEGGPGTPIRPIVSRITFT-GRRLQRRDWX 756 N KT + + L + N ++ + L +GG G P+ + LQRRDW Sbjct: 20 NKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVGDPLESTCRHASLALAVVLQRRDWE 79 Query: 757 KPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 80 NPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 116 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 51.6 bits (118), Expect = 9e-07 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -3 Query: 893 YKLPXAHXRGA--TVGEGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 +K+P + G EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 214 WKMPGRYLTGKLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 267 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 51.6 bits (118), Expect = 9e-07 Identities = 27/57 (47%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = -2 Query: 852 GRPIGAGLLRYYPQLAKRGMCCKAIKLG*RRFXPV-TTL*TTPSECNTTHYRANWGT 685 G+ GL P +RGMCCKAIKLG + P + P CNTTHYRANW + Sbjct: 6 GKGDRCGLFAITPA-GERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANWSS 61 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 51.6 bits (118), Expect = 9e-07 Identities = 36/91 (39%), Positives = 45/91 (49%), Gaps = 3/91 (3%) Frame = +1 Query: 607 SYPLDI--HNVQDHLKELADRYAIEGGPGTPIRPIVSRITFT-GRRLQRRDWXKPALTQL 777 +YP D HN D E A + G G P+ + LQRRDW P +TQL Sbjct: 46 AYPSDSSEHN-HDFTFESATALSESGQHGDPLESTCRHASLALAVVLQRRDWENPGVTQL 104 Query: 778 NRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 NRLAAH PF +++ARTD PS + L Sbjct: 105 NRLAAHPPFASWR-NSEEARTDRPSQQLRSL 134 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 51.6 bits (118), Expect = 9e-07 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF + ++KARTD PS + L Sbjct: 69 LQRRDWENPGVTQLNRLAAHPPFARWR-NSQKARTDRPSQQLRSL 112 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = -3 Query: 863 ATVGEGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 A + EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 2 AQLWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 43 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 51.2 bits (117), Expect = 1e-06 Identities = 31/81 (38%), Positives = 42/81 (51%), Gaps = 1/81 (1%) Frame = +1 Query: 631 VQDHLKELADRYAIEGGPGTPIRPIVSRITFT-GRRLQRRDWXKPALTQLNRLAAHSPFR 807 + + L +A+R G G P+ + LQRRDW P +TQLNRLAAH PF Sbjct: 52 IAEQLHIIAERRIGIAGRGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA 111 Query: 808 QLGVIAKKARTDWPSPTVAPL 870 +++ARTD PS + L Sbjct: 112 SWR-NSEEARTDRPSQQLRSL 131 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 51.2 bits (117), Expect = 1e-06 Identities = 30/59 (50%), Positives = 36/59 (61%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCKRRPVNVIRLTIGRIGVPGPP 675 EG+SVRA ++ KG CAARRLSWV GF QSRRCK ++ + R G PG P Sbjct: 189 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK----TTAKIWLKR-GCPGEP 241 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/45 (53%), Positives = 29/45 (64%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW +TQLNRLAAH PF +++ARTD PS + L Sbjct: 519 LQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 562 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF ++KARTD PS + L Sbjct: 127 LQRRDWENPGVTQLNRLAAHPPFASWR-NSEKARTDRPSQQLRSL 170 >SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 51.2 bits (117), Expect = 1e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF ++KARTD PS + L Sbjct: 62 LQRRDWENPGVTQLNRLAAHPPFASWR-NSEKARTDRPSQQLRSL 105 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 224 LQRRDWENPGVTQLNRLAAHPPFASWRT-SEEARTDRPSQQLRSL 267 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 50.8 bits (116), Expect = 2e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF +++ARTD PS V L Sbjct: 12 LQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQVRSL 55 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_49046| Best HMM Match : BA14K (HMM E-Value=6.4) Length = 120 Score = 50.8 bits (116), Expect = 2e-06 Identities = 26/45 (57%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF I ++ARTD PS + L Sbjct: 33 LQRRDWENPGVTQLNRLAAHPPFASWRNI-EEARTDRPSQQLRSL 76 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 50.8 bits (116), Expect = 2e-06 Identities = 27/43 (62%), Positives = 28/43 (65%) Frame = -2 Query: 852 GRPIGAGLLRYYPQLAKRGMCCKAIKLG*RRFXPVTTL*TTPS 724 GR IGAGL P +RGMCCKAIKLG R PVTT TT S Sbjct: 21 GRAIGAGLFAITPA-GERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 85 >SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 50.8 bits (116), Expect = 2e-06 Identities = 29/58 (50%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK-RRPVNVIRLTIGRIGVPG 681 EG+SVRA ++ KG CAARRLSWV GF QSRRCK + L + G PG Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPG 63 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 482 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 519 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 152 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 189 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 14 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 229 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 266 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 373 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 410 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 226 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 263 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 75 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 112 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 656 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 693 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 894 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 931 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 381 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 418 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 297 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 334 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 565 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 602 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 412 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 449 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 363 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 400 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 39 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 76 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 795 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 832 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 50.4 bits (115), Expect = 2e-06 Identities = 35/93 (37%), Positives = 43/93 (46%), Gaps = 2/93 (2%) Frame = +1 Query: 598 PLKS-YPLDIHNVQDHLKELADRYAIEGGPGTPIRPIVSRITFT-GRRLQRRDWXKPALT 771 PL S Y I+N H PG P+ + LQRRDW P +T Sbjct: 72 PLSSPYNTTINNTLQHYHYQHLTTLPLSSPGDPLESTCRHASLALAVVLQRRDWENPGVT 131 Query: 772 QLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 QLNRLAAH PF +++ARTD PS + L Sbjct: 132 QLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 163 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 456 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 493 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 75 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 112 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 50.4 bits (115), Expect = 2e-06 Identities = 30/81 (37%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Frame = +1 Query: 631 VQDHLKELADRYAIEGGPGTPIRPIVSRITFT-GRRLQRRDWXKPALTQLNRLAAHSPFR 807 ++D+ E D + G P+ + LQRRDW P +TQLNRLAAH PF Sbjct: 153 LRDNSAEQLDHHLSHRSHGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFA 212 Query: 808 QLGVIAKKARTDWPSPTVAPL 870 +++ARTD PS + L Sbjct: 213 SWR-NSEEARTDRPSQQLRSL 232 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 14 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 14 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 89 LQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSL 132 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +1 Query: 676 GGPGTPIRPIVSRITFT-GRRLQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPS 852 GG G P+ + LQRRDW P +TQLNRLAAH PF +++ARTD PS Sbjct: 44 GGIGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPS 102 Query: 853 PTVAPL 870 + L Sbjct: 103 QQLRSL 108 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 377 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 414 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 14 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 1111 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 1148 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 302 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 339 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 116 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 153 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 26 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 63 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 14 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 37 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 74 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 42 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 79 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 273 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 310 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 492 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 529 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 257 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 294 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 100 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 137 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 60 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 97 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 62 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 99 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 536 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 573 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 56 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 93 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 161 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 198 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 21 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 246 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 283 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 271 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 308 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 44 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 81 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +1 Query: 736 LQRRDWXKPALTQLNRLAAHSPFRQLGVIAKKARTDWPSPTVAPL 870 LQRRDW P +TQLNRLAAH PF +++ARTD PS + L Sbjct: 42 LQRRDWENPGVTQLNRLAAHPPFASWS-NSEEARTDRPSQQLRSL 85 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 198 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 235 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 134 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 171 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 455 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 492 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 61 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 98 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 124 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 161 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 290 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 327 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 7 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -3 Query: 851 EGQSVRAFFAITPSWRKGECAARRLSWVNAGFXQSRRCK 735 EG+SVRA ++ KG CAARRLSWV GF QSRRCK Sbjct: 29 EGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,173,360 Number of Sequences: 59808 Number of extensions: 675076 Number of successful extensions: 6250 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6198 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2824376637 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -