BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0142.Seq (961 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK093453-1|BAC04171.1| 339|Homo sapiens protein ( Homo sapiens ... 31 4.7 U22961-2|AAA64921.1| 331|Homo sapiens protein ( ).). 31 6.2 >AK093453-1|BAC04171.1| 339|Homo sapiens protein ( Homo sapiens cDNA FLJ36134 fis, clone TESTI2024648, weakly similar to Homo sapiens germline specific RNA binding protein (DAZL1) mRNA. ). Length = 339 Score = 31.5 bits (68), Expect = 4.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 531 HGIQMIDHAVRKPSSISCTAMKLAPRMFQCACLVIK 424 HG+Q H V PS+I+ A + P +C +IK Sbjct: 276 HGVQATYHQVYAPSAITMPAPVMQPEPIKCGAFIIK 311 >U22961-2|AAA64921.1| 331|Homo sapiens protein ( ).). Length = 331 Score = 31.1 bits (67), Expect = 6.2 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 687 YPNSPYSESYYIHWASFTTS*LGKTCVNPT*SPCST-FPFSPAGGNSEEGPHRL 845 Y S S++ I A +++S G C P +PC T P +P GG ++ RL Sbjct: 70 YRRSCRSKARAIQAADYSSSDRGPPCSCPILAPCGTPHPLAPGGGQGDKEMPRL 123 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,013,288 Number of Sequences: 237096 Number of extensions: 3251141 Number of successful extensions: 8486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8486 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12714176638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -