BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0142.Seq (961 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.1 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.1 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.8 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 559 VALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRY 666 V L +IN+K LK +P D H + D L L Y Sbjct: 870 VPLEGNLMINNKYALKFFPFDKH-ILDKLPTLISNY 904 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 3.1 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 612 PAGHPQRSGSPERTG*PLRNRGGARYPNSP 701 P GHP + + R+G R RY P Sbjct: 1762 PVGHPTNASAHSRSGSQSMPRQNGRYSRVP 1791 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.4 bits (48), Expect = 3.1 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 317 SKATNLLYTRNDVSDSEKKATVE 385 +K T + Y ND+S +E+K T+E Sbjct: 424 AKNTIIDYRNNDLSINEEKRTIE 446 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 284,054 Number of Sequences: 438 Number of extensions: 6444 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31565079 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -