BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0140.Seq (505 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 27 0.072 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.6 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 3.6 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 6.3 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 27.5 bits (58), Expect = 0.072 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 315 SSNAFRFDGWGSRCNYTETLELISQGGWRI 404 + N+ ++ G Y E +EL +GGW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 215 KSN-PQNYNLRKYWCRTSDE 271 KSN N LRKY C+ DE Sbjct: 322 KSNLNHNEQLRKYLCKNEDE 341 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 215 KSN-PQNYNLRKYWCRTSDE 271 KSN N LRKY C+ DE Sbjct: 214 KSNLNHNEQLRKYLCKNEDE 233 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 321 NAFRFDGWGSRCNYTETLELISQGGW 398 +A R+ G Y E +E + GGW Sbjct: 290 DAGRYTGERGMMGYNEIVEAQNAGGW 315 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 437 WLLEPIDIYNVNAPPTLRYK 378 WL P + N P +LR+K Sbjct: 7 WLTPPHSLGNTVTPVSLRFK 26 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,403 Number of Sequences: 336 Number of extensions: 2912 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -