BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0140.Seq (505 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0603 - 17898310-17899457,17899658-17899747,17900853-17901738 29 2.8 01_01_0254 - 2074095-2074100,2074389-2074462,2074572-2074633,207... 28 4.9 >04_03_0603 - 17898310-17899457,17899658-17899747,17900853-17901738 Length = 707 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 4/53 (7%) Frame = -3 Query: 200 YSFIVEVNREHLL----STYFIRKIGTRLRDSNTGAYRSTRMHRTSYPLGHND 54 Y F+ + LL ST F +GTRLR + A +H S+P+ H D Sbjct: 470 YEFVQNKTLKELLDLQRSTRFHVTLGTRLRIAAESAGAFAHLHSLSHPILHGD 522 >01_01_0254 - 2074095-2074100,2074389-2074462,2074572-2074633, 2074790-2075123,2075271-2075487,2075575-2075685, 2076304-2076840 Length = 446 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 325 RFGLMGGAAVVTILRP*NLYLKVGGAFTL*MSMGSSNHLTPG 450 + G++G V+ R + L +GG ++MG + HL G Sbjct: 354 KLGILGALEVIDAARKARIALMIGGMVETRIAMGFAGHLAAG 395 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,094,867 Number of Sequences: 37544 Number of extensions: 303163 Number of successful extensions: 547 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -