BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0140.Seq (505 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 23 4.5 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 4.5 AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein ... 23 4.5 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 5.9 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 23 7.8 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 165 QMFTIDFHDEGITLCNKNQTRKIIICVNTG 254 Q +I H EG+ + RK ++C TG Sbjct: 119 QALSIVHHPEGVMGPTRRMIRKPLVCAITG 148 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = -3 Query: 353 TAAPPIKPKRITASRLK*AGRWYLPVRTHQRSYTSIYA 240 T++P + PK T+ R+ GR+ +QR+ +++ Sbjct: 1130 TSSPALPPKSPTSQRITLPGRYEARNPAYQRTTKDLFS 1167 >AF283269-1|AAG15374.1| 114|Anopheles gambiae ribosomal protein S26 protein. Length = 114 Score = 23.4 bits (48), Expect = 4.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 369 SQYSYNGCPTHQTETHYCFTAEIGRKVVPTRA 274 S YS P + HYC + I KVV R+ Sbjct: 56 SVYSSYVLPKLYAKLHYCVSCAIHSKVVRNRS 87 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 5.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -2 Query: 369 SQYSYNGCPTHQTETHYCFTAEIGRKVVPTR 277 S YN HQT TA+ GRK R Sbjct: 1275 SNCKYNTTQHHQTHHERRTTADFGRKATDGR 1305 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 29 RRGLTDKRSRCGLTDKTY 82 R D S CGL D+TY Sbjct: 631 RTDCNDAHSFCGLRDRTY 648 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,387 Number of Sequences: 2352 Number of extensions: 10505 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45245913 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -