BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0129.Seq (522 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 27 7.1 SB_29266| Best HMM Match : Glyco_hydro_35 (HMM E-Value=0) 27 9.4 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 27 9.4 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 65 PHRKAVLNLYKTLLYLGRDWPQGFDLFRKRLHKVFSKNSEETD 193 PH A +L G++ P+ D K+LH +FS SE D Sbjct: 13 PHSPAKKKAKFSLRLKGKNKPKSSDDSPKKLHPIFSPVSESPD 55 >SB_29266| Best HMM Match : Glyco_hydro_35 (HMM E-Value=0) Length = 568 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 134 NLEANLDPDRGAFYKDSKPLFYVAG 60 +L ++D D F KD KP Y++G Sbjct: 17 SLSFSIDYDNNCFMKDGKPFRYISG 41 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 110 LGRDWPQGFDLFRKRLHKVFSKNSEET 190 LGRD +LFR++ + VFS ++E T Sbjct: 1941 LGRDGRSALELFRRKGYSVFSGSTEFT 1967 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,893,937 Number of Sequences: 59808 Number of extensions: 202211 Number of successful extensions: 646 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -