BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0129.Seq (522 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 25 2.0 AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 24 3.6 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 24.6 bits (51), Expect = 2.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 158 EAFF*TSRNLEANLDPDRGAFYKDSKPLFYVAG 60 + FF N++ NL+ G D KPL +VAG Sbjct: 137 QVFFSDKSNVQ-NLEATGGEAANDGKPLGFVAG 168 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 23.8 bits (49), Expect = 3.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 288 SLHCSVLLQLICASISLTTNSPCFTIICIF 199 SLHCS+ L L S S + CF + C F Sbjct: 40 SLHCSLSLSLSLLSPSFSPIWQCF-VQCFF 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,787 Number of Sequences: 2352 Number of extensions: 7460 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -