BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0127.Seq (933 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 113 1e-25 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 113 1e-25 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 113 1e-25 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 6e-13 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 70 2e-12 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 69 5e-12 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 69 5e-12 SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 68 9e-12 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 67 2e-11 SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) 67 2e-11 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 67 2e-11 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_56677| Best HMM Match : p450 (HMM E-Value=1.1e-10) 66 5e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) 66 5e-11 SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) 66 5e-11 SB_29747| Best HMM Match : Ank (HMM E-Value=0) 66 5e-11 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 66 5e-11 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 65 7e-11 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 65 7e-11 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 65 7e-11 SB_47223| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 9e-11 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 65 9e-11 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 9e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 9e-11 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 64 1e-10 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 64 1e-10 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 64 1e-10 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 64 1e-10 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 64 1e-10 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 64 1e-10 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) 64 1e-10 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 64 1e-10 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 64 1e-10 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 64 1e-10 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 64 1e-10 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 64 1e-10 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 64 1e-10 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 64 1e-10 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 64 1e-10 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 64 1e-10 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 64 1e-10 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 64 1e-10 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 64 1e-10 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 64 1e-10 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 64 1e-10 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 64 1e-10 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 64 1e-10 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 64 1e-10 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 64 1e-10 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 64 1e-10 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 64 1e-10 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 64 1e-10 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 64 1e-10 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 64 1e-10 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 64 1e-10 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 64 1e-10 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 64 1e-10 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 64 1e-10 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 64 1e-10 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 64 1e-10 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 64 1e-10 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 64 1e-10 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 64 1e-10 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43571| Best HMM Match : Ank (HMM E-Value=3e-34) 64 1e-10 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_43290| Best HMM Match : AMP-binding (HMM E-Value=6.5e-16) 64 1e-10 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 64 1e-10 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 64 1e-10 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 64 1e-10 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 64 1e-10 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 64 1e-10 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 64 1e-10 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39465| Best HMM Match : PDH (HMM E-Value=1.5) 64 1e-10 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 64 1e-10 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 64 1e-10 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 64 1e-10 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 64 1e-10 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 64 1e-10 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 64 1e-10 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 64 1e-10 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 64 1e-10 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 64 1e-10 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 64 1e-10 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 64 1e-10 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 64 1e-10 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 64 1e-10 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 64 1e-10 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 64 1e-10 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 64 1e-10 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 64 1e-10 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 64 1e-10 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 64 1e-10 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 64 1e-10 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31585| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 64 1e-10 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 64 1e-10 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 64 1e-10 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 64 1e-10 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 64 1e-10 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 118 bits (283), Expect = 9e-27 Identities = 53/59 (89%), Positives = 53/59 (89%) Frame = -3 Query: 343 QXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPVNCNTTHYRANW 167 Q RNCWEGRSVRASSLLRQLAKGGCAARRL GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 113 bits (273), Expect = 1e-25 Identities = 55/67 (82%), Positives = 57/67 (85%) Frame = -3 Query: 367 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPVNCNT 188 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GFPSHDVVKRRPVNCNT Sbjct: 587 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 641 Query: 187 THYRANW 167 THYRANW Sbjct: 642 THYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 113 bits (273), Expect = 1e-25 Identities = 55/67 (82%), Positives = 57/67 (85%) Frame = -3 Query: 367 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPVNCNT 188 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 187 THYRANW 167 THYRANW Sbjct: 85 THYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 113 bits (273), Expect = 1e-25 Identities = 55/67 (82%), Positives = 57/67 (85%) Frame = -3 Query: 367 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPVNCNT 188 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GFPSHDVVKRRPVNCNT Sbjct: 30 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNCNT 84 Query: 187 THYRANW 167 THYRANW Sbjct: 85 THYRANW 91 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 84.6 bits (200), Expect = 1e-16 Identities = 43/52 (82%), Positives = 44/52 (84%) Frame = -3 Query: 355 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPV 200 PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GFPSHDVVKRRPV Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPV 67 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 73.3 bits (172), Expect = 3e-13 Identities = 36/56 (64%), Positives = 38/56 (67%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTAS 201 RLQ A LLGRAIGAGLF ITPA ERGMC + +SWV P FSQS RC AS Sbjct: 2 RLQAPFAIQAAHLLGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 72.5 bits (170), Expect = 4e-13 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = +3 Query: 201 TGRRFTTS*LGKPWRYPTNRLAAHPPFASWRNSEEARTDRPSQQLR 338 TGRRFT P NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 85 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 72.1 bits (169), Expect = 6e-13 Identities = 40/68 (58%), Positives = 43/68 (63%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPVNCNTTHYRANWVPG 158 RNCWEGRSVRASSLLRQLAKGGCAARRL GF KRRPV + H + + Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV--PSLHACRSTLED 60 Query: 157 PPSSEAIL 134 PP IL Sbjct: 61 PPLETLIL 68 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 71.3 bits (167), Expect = 1e-12 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTPGF 234 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI VTP F Sbjct: 1835 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 Score = 62.1 bits (144), Expect = 6e-10 Identities = 36/67 (53%), Positives = 42/67 (62%), Gaps = 3/67 (4%) Frame = -3 Query: 358 LPFAIQXRNCWEGRSVRASSL-LRQLAKGG--CAARRLVG*RQGFPSHDVVKRRPVNCNT 188 +PFAIQ GR++ A + + G C A +LV FPSHDVVKRRPVNCNT Sbjct: 1836 VPFAIQAAQLL-GRAIGAGLFAITPAGERGMCCKAIKLV--TPVFPSHDVVKRRPVNCNT 1892 Query: 187 THYRANW 167 THYRANW Sbjct: 1893 THYRANW 1899 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 70.9 bits (166), Expect = 1e-12 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPV 200 RNCWEGRSVRASSLLRQLAKGGCAARRL GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 70.9 bits (166), Expect = 1e-12 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPV 200 RNCWEGRSVRASSLLRQLAKGGCAARRL GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 70.9 bits (166), Expect = 1e-12 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPV 200 RNCWEGRSVRASSLLRQLAKGGCAARRL GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 70.9 bits (166), Expect = 1e-12 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPV 200 RNCWEGRSVRASSLLRQLAKGGCAARRL GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 70.9 bits (166), Expect = 1e-12 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPV 200 RNCWEGRSVRASSLLRQLAKGGCAARRL GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 70.9 bits (166), Expect = 1e-12 Identities = 35/46 (76%), Positives = 35/46 (76%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPV 200 RNCWEGRSVRASSLLRQLAKGGCAARRL GF KRRPV Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 70.1 bits (164), Expect = 2e-12 Identities = 36/55 (65%), Positives = 42/55 (76%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTA 204 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI TP ++R+ T+ Sbjct: 1121 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARKFGETS 1173 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 68.9 bits (161), Expect = 5e-12 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 339 CATVGKGDRCGPLRYYASWRKGDVLQGD 256 CATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 245 CATVGKGDRCGPLRYYASWRKGDVLQGD 272 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 68.9 bits (161), Expect = 5e-12 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 339 CATVGKGDRCGPLRYYASWRKGDVLQGD 256 CATVGKGDRCGPLRYYASWRKGDVLQGD Sbjct: 91 CATVGKGDRCGPLRYYASWRKGDVLQGD 118 Score = 64.1 bits (149), Expect = 2e-10 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -3 Query: 355 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 59 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTAS 201 GR++ A + + G + +SWVTPGFSQSRRCKTTAS Sbjct: 30 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 68.5 bits (160), Expect = 7e-12 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -1 Query: 354 HSPFXCATVGKGDRCGPLRYYASWRKGDVLQGD 256 HSPF GKGDRCGPLRYYASWRKGDVLQGD Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQGD 36 >SB_22630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 68.5 bits (160), Expect = 7e-12 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -1 Query: 354 HSPFXCATVGKGDRCGPLRYYASWRKGDVLQGD 256 HSPF GKGDRCGPLRYYASWRKGDVLQGD Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQGD 36 >SB_35241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 68.5 bits (160), Expect = 7e-12 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -1 Query: 354 HSPFXCATVGKGDRCGPLRYYASWRKGDVLQGD 256 HSPF GKGDRCGPLRYYASWRKGDVLQGD Sbjct: 11 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQGD 43 >SB_3376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 68.5 bits (160), Expect = 7e-12 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = -1 Query: 354 HSPFXCATVGKGDRCGPLRYYASWRKGDVLQGD 256 HSPF GKGDRCGPLRYYASWRKGDVLQGD Sbjct: 4 HSPFRLRNCGKGDRCGPLRYYASWRKGDVLQGD 36 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 68.1 bits (159), Expect = 9e-12 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 379 QNINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 ++++ + P+ + RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 518 ESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 566 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASE 198 GR++ A + + G + +SWVTPGFSQSRRCKTTASE Sbjct: 537 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 68.1 bits (159), Expect = 9e-12 Identities = 42/106 (39%), Positives = 56/106 (52%), Gaps = 3/106 (2%) Frame = -3 Query: 355 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVK---RRPVNCNTT 185 PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GF K + C Sbjct: 21 PFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQV 78 Query: 184 HYRANWVPGPPSSEAILLTIRITFTS*HELRTFSKEKYVKTLQTFF 47 R + G S + ++L ++ H+L + +V T + ++ Sbjct: 79 DSRGSPRAGDRSLQLLILNEEFLVSASHQLALITSLPFVHTARRYY 124 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 68.1 bits (159), Expect = 9e-12 Identities = 37/51 (72%), Positives = 40/51 (78%) Frame = -2 Query: 386 ILTKY*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTPGF 234 IL R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI + PGF Sbjct: 104 ILRAQGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIK-LEPGF 151 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +3 Query: 201 TGRRFTTS*LGKPWRYPTNRLAAHPPFASWRNSEEARTDRPSQQLR 338 TGRR P NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 60 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +3 Query: 201 TGRRFTTS*LGKPWRYPTNRLAAHPPFASWRNSEEARTDRPSQQLR 338 TGRR P NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 80 >SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 67.7 bits (158), Expect = 1e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTP 240 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI V P Sbjct: 30 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVEP 70 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +3 Query: 201 TGRRFTTS*LGKPWRYPTNRLAAHPPFASWRNSEEARTDRPSQQLR 338 TGRR P NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 70 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +3 Query: 201 TGRRFTTS*LGKPWRYPTNRLAAHPPFASWRNSEEARTDRPSQQLR 338 TGRR P NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 90 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 67.7 bits (158), Expect = 1e-11 Identities = 33/46 (71%), Positives = 33/46 (71%) Frame = +3 Query: 201 TGRRFTTS*LGKPWRYPTNRLAAHPPFASWRNSEEARTDRPSQQLR 338 TGRR P NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 117 >SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3287 Score = 67.7 bits (158), Expect = 1e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -2 Query: 377 KY*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAI 255 KY R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI Sbjct: 3080 KYGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 3118 >SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVT 243 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI VT Sbjct: 75 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 114 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -3 Query: 376 NINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 N+ A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 440 NMGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 485 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL 195 GR++ A + + G + +SWVTPGFSQSRRCKTTASEL Sbjct: 456 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 67.3 bits (157), Expect = 2e-11 Identities = 43/87 (49%), Positives = 51/87 (58%), Gaps = 5/87 (5%) Frame = -3 Query: 358 LPFA--IQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVK---RRPVNC 194 +PF ++ RNCWEGRSVRASSLLRQLAKGGCAARRL GF K + C Sbjct: 92 IPFVALLKLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLAC 151 Query: 193 NTTHYRANWVPGPPSSEAILLTIRITF 113 R + PGP + +LL IR+ F Sbjct: 152 LQVDSRGS--PGPKRN--LLLLIRVRF 174 >SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) Length = 173 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVT 243 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI VT Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVT 41 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 67.3 bits (157), Expect = 2e-11 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 361 NLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 +L ++I+ RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 457 SLFYSIRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 499 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTA 204 GR++ A + + G + +SWVTPGFSQSRRCKTTA Sbjct: 470 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTA 509 >SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 66.9 bits (156), Expect = 2e-11 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -1 Query: 378 KILTLTICHSPFXCATVGKGDRCGPLRYYASWRKGDVLQG 259 K+ L + CATVGKGDRCGPLRYYASWRKGDVLQG Sbjct: 50 KLACLQVDSRGSPCATVGKGDRCGPLRYYASWRKGDVLQG 89 Score = 63.7 bits (148), Expect = 2e-10 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -3 Query: 337 RNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 3 RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 37 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/71 (40%), Positives = 37/71 (52%), Gaps = 4/71 (5%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASE----L*YDSL*GELGTG 159 GR++ A + + G + +SWVTPGFSQSRRCKTTAS L DS T Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCATV 66 Query: 158 PPXERGNPINY 126 +R P+ Y Sbjct: 67 GKGDRCGPLRY 77 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 66.9 bits (156), Expect = 2e-11 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 253 VG*RQGFPSHDVVKRRPVNCNTTHYRANW 167 +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 74 LGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -2 Query: 338 AQLLGRAIGAGLFAITPAGERG 273 AQLLGRAIGAGLFAITPAGE+G Sbjct: 44 AQLLGRAIGAGLFAITPAGEKG 65 >SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 437 Score = 66.9 bits (156), Expect = 2e-11 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -2 Query: 374 Y*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSR 222 Y R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI V + +R Sbjct: 179 YGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVQIDHTSNR 227 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.5 bits (155), Expect = 3e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 339 CATVGKGDRCGPLRYYASWRKGDVLQG 259 CATVGKGDRCGPLRYYASWRKGDVLQG Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQG 28 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 257 ISWVTPGFSQSRRCKTTASEL 195 +SWVTPGFSQSRRCKTTASEL Sbjct: 30 LSWVTPGFSQSRRCKTTASEL 50 >SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 66.1 bits (154), Expect = 4e-11 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 4/39 (10%) Frame = +3 Query: 234 KPWRYP----TNRLAAHPPFASWRNSEEARTDRPSQQLR 338 + W +P NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 585 RDWEFPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLR 623 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWE PGVTQL L P Sbjct: 578 LAVVLQRRDWEFPGVTQLNRLAAHP 602 >SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 66.1 bits (154), Expect = 4e-11 Identities = 36/55 (65%), Positives = 39/55 (70%) Frame = -2 Query: 359 FAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL 195 FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI V F + K T E+ Sbjct: 12 FAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVITHFIECLCEKYTTGEM 64 >SB_56677| Best HMM Match : p450 (HMM E-Value=1.1e-10) Length = 606 Score = 65.7 bits (153), Expect = 5e-11 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = -3 Query: 379 QNINAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRL 254 + NA N P + RNCWEGRSVRASSLLRQLAKGGCAARRL Sbjct: 375 ERFNAENAPNML--RNCWEGRSVRASSLLRQLAKGGCAARRL 414 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 65.7 bits (153), Expect = 5e-11 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 280 KGGCAARRLVG*RQGFPSHDVVKRRPVNCNTTHYRANW 167 +G C +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 RGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 329 LGRAIGAGLFAITPAGERGMCCKAI 255 +G+ GLFAITPAGERGMCCKAI Sbjct: 5 VGKGDRCGLFAITPAGERGMCCKAI 29 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = -1 Query: 339 CATVGKGDRCGPLRYYASWRKGDVLQGD*LGNARVFP 229 CATVGKGDRCG + +G + LGNA+ FP Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.7 bits (153), Expect = 5e-11 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = -3 Query: 355 PFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 P A + RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 52 PQAPRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 92 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTAS 201 GR++ A + + G + +SWVTPGFSQSRRCKTTAS Sbjct: 63 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) Length = 405 Score = 65.7 bits (153), Expect = 5e-11 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVT 243 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI V+ Sbjct: 94 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLVS 133 >SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) Length = 1169 Score = 65.7 bits (153), Expect = 5e-11 Identities = 44/94 (46%), Positives = 52/94 (55%), Gaps = 2/94 (2%) Frame = -2 Query: 530 STFFNSGPCSKLEQHSTLSRSILLIYKGFCRFRPIG*KMS*FNKNLTRILTKY*--RLQF 357 S F GP ++ + + L I+ G+ R T L KY R+ F Sbjct: 685 SRSFQRGPVNRKSHSAVVCGDCLFIFGGYIDIR-----------GATNELWKYDIGRVPF 733 Query: 356 AIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAI 255 AI+ AQLLGRAIGAGLFAITPAGERGMCCKAI Sbjct: 734 AIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 765 >SB_29747| Best HMM Match : Ank (HMM E-Value=0) Length = 416 Score = 65.7 bits (153), Expect = 5e-11 Identities = 39/72 (54%), Positives = 45/72 (62%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLRX*MANGKL*ALIFC*NSR*IFVKSAHFLTNRP 434 NRLAAHPPFASWRNSEEARTDRPSQQLR NG+ A C + + +A + R Sbjct: 309 NRLAAHPPFASWRNSEEARTDRPSQQLR--SLNGEWDAP--CSGA----LSAAGVVVTRS 360 Query: 435 KSAKSLINQKNR 470 K L+N K R Sbjct: 361 NGGKGLLNTKER 372 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 291 LAVVLQRRDWENPGVTQLNRLAAHP 315 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 65.7 bits (153), Expect = 5e-11 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = -3 Query: 373 INAYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 + A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 175 VGASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 219 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL 195 GR++ A + + G + +SWVTPGFSQSRRCKTTASEL Sbjct: 190 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 65.3 bits (152), Expect = 7e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -2 Query: 383 LTKY*RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAI 255 L+ + R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI Sbjct: 1939 LSVFGRVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 1979 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 65.3 bits (152), Expect = 7e-11 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 343 QXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 Q RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 888 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 924 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL 195 GR++ A + + G + +SWVTPGFSQSRRCKTTASEL Sbjct: 895 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 65.3 bits (152), Expect = 7e-11 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = -3 Query: 364 YNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -2 Query: 359 FAIRHSXAQLL-GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTAS 201 FAI+ AQL GR++ A + + G + +SWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 65.3 bits (152), Expect = 7e-11 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -3 Query: 346 IQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 I+ RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 239 IRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 276 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL 195 GR++ A + + G + +SWVTPGFSQSRRCKTTASEL Sbjct: 247 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.3 bits (152), Expect = 7e-11 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = -3 Query: 364 YNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 + PFAIQ WEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 8 HQAPFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 51 Score = 48.0 bits (109), Expect = 1e-05 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = -2 Query: 359 FAIRHSXAQLL-GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTAS 201 FAI+ AQL GR++ A + + G + +SWVTPGFSQSRRCKTTAS Sbjct: 12 FAIQ--AAQLWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 65.3 bits (152), Expect = 7e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWV 246 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI V Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLV 40 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 65.3 bits (152), Expect = 7e-11 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 343 QXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 Q RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 164 QLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 200 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 NRLAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTAS 201 GR++ A + + G + +SWVTPGFSQSRRCKTTAS Sbjct: 171 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 211 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 65.3 bits (152), Expect = 7e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWV 246 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI V Sbjct: 256 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLV 294 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 65.3 bits (152), Expect = 7e-11 Identities = 35/66 (53%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -3 Query: 358 LPFAIQXRNCWEGRSVRASSLLRQLA--KGGCAARRLVG*RQGFPSHDVVKRRPVNCNTT 185 +PFAIQ GR++ A A +G C +G FPSHDVVKRRPVNCNTT Sbjct: 3 VPFAIQAAQLL-GRAIGAGLFAITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTT 61 Query: 184 HYRANW 167 HYRANW Sbjct: 62 HYRANW 67 Score = 64.5 bits (150), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAI 255 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) Length = 745 Score = 65.3 bits (152), Expect = 7e-11 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWV 246 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI V Sbjct: 386 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLV 424 >SB_47223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 64.9 bits (151), Expect = 9e-11 Identities = 34/45 (75%), Positives = 35/45 (77%) Frame = -3 Query: 361 NLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPS 227 NLP + RNCWEGRSVRASSLLRQLAKGGCAARRL G PS Sbjct: 243 NLPRRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWTLFGVPS 285 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 64.9 bits (151), Expect = 9e-11 Identities = 37/56 (66%), Positives = 40/56 (71%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTAS 201 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI S S C+ AS Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAIKLDVDECSSS-PCQNGAS 54 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 64.9 bits (151), Expect = 9e-11 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +3 Query: 249 PTNRLAAHPPFASWRNSEEARTDRPSQQLR 338 P NRL AHPPFASWRNSEEARTDRPSQQLR Sbjct: 82 PLNRLEAHPPFASWRNSEEARTDRPSQQLR 111 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAV LQR DW+NPGVT L L+ P Sbjct: 66 LAVGLQRLDWKNPGVTPLNRLEAHP 90 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 64.9 bits (151), Expect = 9e-11 Identities = 42/72 (58%), Positives = 45/72 (62%) Frame = -3 Query: 367 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGFPSHDVVKRRPVNCNT 188 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GF RR C T Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQ----SRR---CKT 52 Query: 187 THYRANWVPGPP 152 T A+ PG P Sbjct: 53 T---ASEFPGDP 61 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 103 NRLAAHPPFASWRNSEEARTDRPSQQLR 130 Score = 51.6 bits (118), Expect = 9e-07 Identities = 31/72 (43%), Positives = 39/72 (54%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL*YDSL*GELGTGPPXE 147 GR++ A + + G + +SWVTPGFSQSRRCKTTASE D L E PP Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPLVLE---RPPPR 70 Query: 146 RGNPINYSNNVY 111 + YS + Y Sbjct: 71 WSSNSPYSESYY 82 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHP 109 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 80 NRLAAHPPFASWRNSEEARTDRPSQQLR 107 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 62 [lacZ-alpha fragment, 54 aa] 115 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 62 NRLAAHPPFASWRNSEEARTDRPSQQLR 89 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHP 68 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 80 NRLAAHPPFASWRNSEEARTDRPSQQLR 107 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHP 86 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 60 NRLAAHPPFASWRNSEEARTDRPSQQLR 87 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHP 66 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 NRLAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 NRLAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 NRLAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 88 NRLAAHPPFASWRNSEEARTDRPSQQLR 115 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHP 94 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 367 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 2 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 44 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL 195 GR++ A + + G + +SWVTPGFSQSRRCKTTASEL Sbjct: 15 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 64 NRLAAHPPFASWRNSEEARTDRPSQQLR 91 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 43 NRLAAHPPFASWRNSEEARTDRPSQQLR 70 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 25 [lacZ-alpha fragment, 54 aa] 78 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 NRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 77 NRLAAHPPFASWRNSEEARTDRPSQQLR 104 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 71 NRLAAHPPFASWRNSEEARTDRPSQQLR 98 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHP 77 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 87 NRLAAHPPFASWRNSEEARTDRPSQQLR 114 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 NRLAAHPPFASWRNSEEARTDRPSQQLR 85 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 234 NRLAAHPPFASWRNSEEARTDRPSQQLR 261 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHP 240 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 129 NRLAAHPPFASWRNSEEARTDRPSQQLR 156 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHP 135 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 NRLAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 49 [lacZ-alpha fragment, 54 aa] 102 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 NRLAAHPPFASWRNSEEARTDRPSQQLR 73 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 28 [lacZ-alpha fragment, 54 aa] 81 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 65 NRLAAHPPFASWRNSEEARTDRPSQQLR 92 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHP 71 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 399 NRLAAHPPFASWRNSEEARTDRPSQQLR 426 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHP 405 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 29 [lacZ-alpha fragment, 54 aa] 82 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 125 NRLAAHPPFASWRNSEEARTDRPSQQLR 152 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHP 131 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 101 NRLAAHPPFASWRNSEEARTDRPSQQLR 128 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHP 107 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 26 NRLAAHPPFASWRNSEEARTDRPSQQLR 53 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHP 32 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 36 NRLAAHPPFASWRNSEEARTDRPSQQLR 63 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 NRLAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 121 NRLAAHPPFASWRNSEEARTDRPSQQLR 148 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHP 127 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 NRLAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHP 69 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 358 NRLAAHPPFASWRNSEEARTDRPSQQLR 385 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHP 364 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 98 NRLAAHPPFASWRNSEEARTDRPSQQLR 125 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHP 104 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 NRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 77 NRLAAHPPFASWRNSEEARTDRPSQQLR 104 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHP 83 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 152 NRLAAHPPFASWRNSEEARTDRPSQQLR 179 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHP 158 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 81 NRLAAHPPFASWRNSEEARTDRPSQQLR 108 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 161 NRLAAHPPFASWRNSEEARTDRPSQQLR 188 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHP 167 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 851 NRLAAHPPFASWRNSEEARTDRPSQQLR 878 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 833 [lacZ-alpha fragment, 54 aa] 886 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 78 NRLAAHPPFASWRNSEEARTDRPSQQLR 105 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHP 84 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 91 NRLAAHPPFASWRNSEEARTDRPSQQLR 118 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHP 97 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHP 59 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 74 NRLAAHPPFASWRNSEEARTDRPSQQLR 101 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_56401| Best HMM Match : Moricin (HMM E-Value=5.8) Length = 106 Score = 64.5 bits (150), Expect = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 368 RLQFAIRHSXAQLLGRAIGAGLFAITPAGERGMCCKAI 255 R+ FAI+ AQLLGRAIGAGLFAITPAGERGMCCKAI Sbjct: 2 RVPFAIQ--AAQLLGRAIGAGLFAITPAGERGMCCKAI 37 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 87 NRLAAHPPFASWRNSEEARTDRPSQQLR 114 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHP 93 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 83 NRLAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQR DWENPGVTQL L P Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHP 89 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 274 NRLAAHPPFASWRNSEEARTDRPSQQLR 301 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHP 280 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 132 NRLAAHPPFASWRNSEEARTDRPSQQLR 159 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 114 [lacZ-alpha fragment, 54 aa] 167 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 68 NRLAAHPPFASWRNSEEARTDRPSQQLR 95 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHP 74 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 NRLAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 119 NRLAAHPPFASWRNSEEARTDRPSQQLR 146 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHP 125 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 132 NRLAAHPPFASWRNSEEARTDRPSQQLR 159 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHP 138 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 39 [lacZ-alpha fragment, 54 aa] 92 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 38 NRLAAHPPFASWRNSEEARTDRPSQQLR 65 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 NRLAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 NRLAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHP 61 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 64.5 bits (150), Expect = 1e-10 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 367 AYNLPFAIQXRNCWEGRSVRASSLLRQLAKGGCAARRLVG*RQGF 233 A + PF + RNCWEGRSVRASSLLRQLAKGGCAARRL GF Sbjct: 214 ASHSPFRL--RNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGF 256 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/44 (54%), Positives = 30/44 (68%) Frame = -2 Query: 326 GRAIGAGLFAITPAGERGMCCKAISWVTPGFSQSRRCKTTASEL 195 GR++ A + + G + +SWVTPGFSQSRRCKTTASEL Sbjct: 227 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 29 NRLAAHPPFASWRNSEEARTDRPSQQLR 56 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 11 [lacZ-alpha fragment, 54 aa] 64 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 37 NRLAAHPPFASWRNSEEARTDRPSQQLR 64 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 19 [lacZ-alpha fragment, 54 aa] 72 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 414 NRLAAHPPFASWRNSEEARTDRPSQQLR 441 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHP 420 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 NRLAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHP 69 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 NRLAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 137 NRLAAHPPFASWRNSEEARTDRPSQQLR 164 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHP 143 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 73 NRLAAHPPFASWRNSEEARTDRPSQQLR 100 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 83 NRLAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 86 NRLAAHPPFASWRNSEEARTDRPSQQLR 113 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHP 92 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 432 NRLAAHPPFASWRNSEEARTDRPSQQLR 459 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHP 438 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 129 NRLAAHPPFASWRNSEEARTDRPSQQLR 156 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHP 135 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 NRLAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 74 NRLAAHPPFASWRNSEEARTDRPSQQLR 101 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHP 80 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 64 NRLAAHPPFASWRNSEEARTDRPSQQLR 91 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHP 70 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 179 NRLAAHPPFASWRNSEEARTDRPSQQLR 206 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHP 185 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 83 NRLAAHPPFASWRNSEEARTDRPSQQLR 110 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHP 89 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 70 NRLAAHPPFASWRNSEEARTDRPSQQLR 97 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHP 76 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 106 NRLAAHPPFASWRNSEEARTDRPSQQLR 133 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 88 [lacZ-alpha fragment, 54 aa] 141 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 NRLAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHP 78 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 55 NRLAAHPPFASWRNSEEARTDRPSQQLR 82 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 37 [lacZ-alpha fragment, 54 aa] 90 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 81 NRLAAHPPFASWRNSEEARTDRPSQQLR 108 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHP 87 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 24 NRLAAHPPFASWRNSEEARTDRPSQQLR 51 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 200 HWPSFYNVVTGKTLALPN*SPCST-SPFRQLA**RRGPHRSPFPTVAXLNGEWQIV 364 HWPSFYNVVTGKTL + + + PF P + LNGEW+++ Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLM 60 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 60 NRLAAHPPFASWRNSEEARTDRPSQQLR 87 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHP 66 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 203 NRLAAHPPFASWRNSEEARTDRPSQQLR 230 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHP 209 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 NRLAAHPPFASWRNSEEARTDRPSQQLR 85 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHP 64 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 72 NRLAAHPPFASWRNSEEARTDRPSQQLR 99 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHP 78 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 NRLAAHPPFASWRNSEEARTDRPSQQLR 96 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 52 NRLAAHPPFASWRNSEEARTDRPSQQLR 79 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHP 58 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 NRLAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 57 NRLAAHPPFASWRNSEEARTDRPSQQLR 84 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHP 63 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 150 NRLAAHPPFASWRNSEEARTDRPSQQLR 177 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 132 [lacZ-alpha fragment, 54 aa] 185 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 59 NRLAAHPPFASWRNSEEARTDRPSQQLR 86 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHP 65 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 102 NRLAAHPPFASWRNSEEARTDRPSQQLR 129 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHP 108 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 NRLAAHPPFASWRNSEEARTDRPSQQLR 67 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 171 NRLAAHPPFASWRNSEEARTDRPSQQLR 198 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 153 [lacZ-alpha fragment, 54 aa] 206 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 358 NRLAAHPPFASWRNSEEARTDRPSQQLR 385 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHP 364 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 108 NRLAAHPPFASWRNSEEARTDRPSQQLR 135 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 90 LAVVLQRRDWENTGVTQLNRLAAHP 114 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 57 [lacZ-alpha fragment, 54 aa] 110 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 39 NRLAAHPPFASWRNSEEARTDRPSQQLR 66 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 21 [lacZ-alpha fragment, 54 aa] 74 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 65 NRLAAHPPFASWRNSEEARTDRPSQQLR 92 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/54 (48%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 L VVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 127 NRLAAHPPFASWRNSEEARTDRPSQQLR 154 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHP 133 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRD EN GVTQL L P Sbjct: 29 LAVVLQRRDGENTGVTQLNRLAAHP 53 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 104 NRLAAHPPFASWRNSEEARTDRPSQQLR 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHP 110 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 78 NRLAAHPPFASWRNSEEARTDRPSQQLR 105 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 60 [lacZ-alpha fragment, 54 aa] 113 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 312 NRLAAHPPFASWRNSEEARTDRPSQQLR 339 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHP 318 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 76 NRLAAHPPFASWRNSEEARTDRPSQQLR 103 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHP 82 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 34 NRLAAHPPFASWRNSEEARTDRPSQQLR 61 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 54 NRLAAHPPFASWRNSEEARTDRPSQQLR 81 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHP 60 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 429 NRLAAHPPFASWRNSEEARTDRPSQQLR 456 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHP 435 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 113 NRLAAHPPFASWRNSEEARTDRPSQQLR 140 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHP 119 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 NRLAAHPPFASWRNSEEARTDRPSQQLR 96 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHP 75 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 60 NRLAAHPPFASWRNSEEARTDRPSQQLR 87 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHP 66 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 111 NRLAAHPPFASWRNSEEARTDRPSQQLR 138 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHP 117 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 229 NRLAAHPPFASWRNSEEARTDRPSQQLR 256 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHP 235 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 231 NRLAAHPPFASWRNSEEARTDRPSQQLR 258 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 213 [lacZ-alpha fragment, 54 aa] 266 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 51 NRLAAHPPFASWRNSEEARTDRPSQQLR 78 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 33 [lacZ-alpha fragment, 54 aa] 86 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 66 NRLAAHPPFASWRNSEEARTDRPSQQLR 93 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 48 [lacZ-alpha fragment, 54 aa] 101 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 56 NRLAAHPPFASWRNSEEARTDRPSQQLR 83 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHP 62 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 61 NRLAAHPPFASWRNSEEARTDRPSQQLR 88 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHP 67 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 165 NRLAAHPPFASWRNSEEARTDRPSQQLR 192 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHP 171 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 69 NRLAAHPPFASWRNSEEARTDRPSQQLR 96 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 51 LAVVLQRRDWENTGVTQLNRLAAHP 75 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 63 NRLAAHPPFASWRNSEEARTDRPSQQLR 90 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHP 69 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 53 NRLAAHPPFASWRNSEEARTDRPSQQLR 80 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHP 59 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 73 NRLAAHPPFASWRNSEEARTDRPSQQLR 100 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHP 79 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 58 NRLAAHPPFASWRNSEEARTDRPSQQLR 85 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 40 [lacZ-alpha fragment, 54 aa] 93 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 93 NRLAAHPPFASWRNSEEARTDRPSQQLR 120 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 75 [lacZ-alpha fragment, 54 aa] 128 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 213 NRLAAHPPFASWRNSEEARTDRPSQQLR 240 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHP 219 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 70 NRLAAHPPFASWRNSEEARTDRPSQQLR 97 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 52 LAVVLQRRDWENTGVTQLNRLAAHP 76 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 71 NRLAAHPPFASWRNSEEARTDRPSQQLR 98 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHP 77 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 50 NRLAAHPPFASWRNSEEARTDRPSQQLR 77 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHP 56 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 104 NRLAAHPPFASWRNSEEARTDRPSQQLR 131 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHP 110 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 40 NRLAAHPPFASWRNSEEARTDRPSQQLR 67 Score = 44.0 bits (99), Expect = 2e-04 Identities = 27/54 (50%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIAL-QHIPLSP--AGVIAKRPAPIALPNSCAXEWRM 354 LAVVLQRRDWENPGVTQL L H P + A+ P S EWR+ Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHP 53 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 67 NRLAAHPPFASWRNSEEARTDRPSQQLR 94 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHP 73 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) Length = 241 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 169 NRLAAHPPFASWRNSEEARTDRPSQQLR 196 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 151 LAVVLQRRDWENTGVTQLNRLAAHP 175 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 205 NRLAAHPPFASWRNSEEARTDRPSQQLR 232 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHP 211 >SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 46 NRLAAHPPFASWRNSEEARTDRPSQQLR 73 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWEN GVTQL L P Sbjct: 28 LAVVLQRRDWENTGVTQLNRLAAHP 52 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 47 NRLAAHPPFASWRNSEEARTDRPSQQLR 74 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHP 53 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 75 NRLAAHPPFASWRNSEEARTDRPSQQLR 102 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHP 81 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 64.5 bits (150), Expect = 1e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 255 NRLAAHPPFASWRNSEEARTDRPSQQLR 338 NRLAAHPPFASWRNSEEARTDRPSQQLR Sbjct: 85 NRLAAHPPFASWRNSEEARTDRPSQQLR 112 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = +1 Query: 202 LAVVLQRRDWENPGVTQLIALQHIP 276 LAVVLQRRDWENPGVTQL L P Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHP 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,784,853 Number of Sequences: 59808 Number of extensions: 549411 Number of successful extensions: 11021 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10979 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2717121828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -