BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0127.Seq (933 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78543-5|CAH10796.1| 1453|Caenorhabditis elegans Hypothetical pr... 29 6.3 Z78543-4|CAB01754.1| 1785|Caenorhabditis elegans Hypothetical pr... 29 6.3 >Z78543-5|CAH10796.1| 1453|Caenorhabditis elegans Hypothetical protein F29G6.3c protein. Length = 1453 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 Query: 114 LPADMNYALSAKKNMSKHYKHFFFRLATSEINSTR 10 +PA N A+S K+ +S+H H F LAT + TR Sbjct: 906 VPAHSNVAVSDKEPISRH--HNFVPLATKTVEETR 938 >Z78543-4|CAB01754.1| 1785|Caenorhabditis elegans Hypothetical protein F29G6.3b protein. Length = 1785 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -1 Query: 114 LPADMNYALSAKKNMSKHYKHFFFRLATSEINSTR 10 +PA N A+S K+ +S+H H F LAT + TR Sbjct: 906 VPAHSNVAVSDKEPISRH--HNFVPLATKTVEETR 938 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,749,105 Number of Sequences: 27780 Number of extensions: 406435 Number of successful extensions: 818 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 799 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2402214122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -