BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0127.Seq (933 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb... 29 3.3 At1g43690.1 68414.m05019 ubiquitin interaction motif-containing ... 29 4.4 >At1g19230.1 68414.m02393 respiratory burst oxidase protein E (RbohE) / NADPH oxidase nearly identical to respiratory burst oxidase protein E GI:3242787 [gi:3242787] from [Arabidopsis thaliana] Length = 926 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 524 TWTPTSK--GEKPSIRAMAHYVNHHPNQVFWGRGAVK 628 T TPTS G+K +++A ++V P V W RG ++ Sbjct: 777 TATPTSTHGGKKKAVKAHFYWVTREPGSVEWFRGVME 813 >At1g43690.1 68414.m05019 ubiquitin interaction motif-containing protein contains Pfam profile PF02809: Ubiquitin interaction motif Length = 599 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = +2 Query: 434 EIGKIPYKSKE*TEIGLSVVPVWNKVHY*RTWTPTSKGEKPSIRAMAHYVNHHP 595 E G +P + T++ +SV P W Y P S EK S V H P Sbjct: 522 EGGMVPMQRPRLTKLNVSVPPKWTPEEYMTCALPPSSSEKDSEVNQPKPVQHAP 575 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,603,963 Number of Sequences: 28952 Number of extensions: 370912 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2227127592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -