BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0116.Seq (960 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 7.9 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 24 7.9 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.8 bits (49), Expect = 7.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 588 RNPLNIGFTFK*YIK*GRQRKSDLTHNYHIHNILQFI 478 R +N+G + YI +DL H +H+H F+ Sbjct: 515 RVKINLGDIVELYILDLTPSVNDLNHPFHLHGYQMFV 551 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.8 bits (49), Expect = 7.9 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -2 Query: 872 RFWAQPTAFRSPQXLSQRSAISXSPLRCQSRVCYPMGTGNRS 747 +++ +PT F + L+ R A S + P G G+RS Sbjct: 420 KYFHRPTEFIPERWLNDRDASIPSAKEVNPFIFLPFGFGSRS 461 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 875,521 Number of Sequences: 2352 Number of extensions: 17776 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 105430005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -