BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0111.Seq (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 26 1.5 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 3.4 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 4.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.9 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.8 bits (54), Expect = 1.5 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 7/41 (17%) Frame = -1 Query: 559 NLFL-IKLVFNNYYYYCFTQC--AGYYL----MSIRLINLI 458 NL L IK YYYY FTQC YL +++RL+ L+ Sbjct: 10 NLALPIKPARTVYYYYLFTQCNPLSTYLYRTILALRLVTLL 50 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +1 Query: 307 GFANGLASFRTCQIMGERIGSSESFSFGNSKNSNRKC 417 GF G ++ + Q++ + S + SFG + N +++C Sbjct: 535 GFRRGRSTVQAIQLVVD--AGSHAMSFGRTNNRDKRC 569 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.2 bits (50), Expect = 4.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 303 CEAYPEPSCGCPVET*ASNLFVHST 229 C++Y CGCP A N++ T Sbjct: 335 CDSYSSSQCGCPDIPPAPNMWPSMT 359 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 7.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 Query: 342 TCSKRCQAICKTFCEAYPEPSCG 274 TC C CK FC E +CG Sbjct: 518 TCGD-CHQECKDFCYGPNEDNCG 539 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 787,130 Number of Sequences: 2352 Number of extensions: 16231 Number of successful extensions: 68 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -