BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0111.Seq (772 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC070377-1|AAH70377.1| 117|Homo sapiens mediator complex subuni... 46 2e-04 >BC070377-1|AAH70377.1| 117|Homo sapiens mediator complex subunit 11 protein. Length = 117 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/42 (47%), Positives = 31/42 (73%) Frame = +2 Query: 245 KLLAQVSTGQPHEGSGYASQKVLQMAWHRLEHVRSWVNELDR 370 + L QV+TGQPHEGS Y+S+K QMA R+++ R ++++ R Sbjct: 68 RYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVAR 109 Score = 44.0 bits (99), Expect = 6e-04 Identities = 21/62 (33%), Positives = 36/62 (58%) Frame = +3 Query: 69 ERIQVLDEIEKDIITXXXXXXXXXXELSKEKSGQKQAESNTSQFLRTLSQVESKLSEQIN 248 ER++ L++IE++I ELSKEK+ ++ + + F ++ VE++LS QI Sbjct: 9 ERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIR 68 Query: 249 YL 254 YL Sbjct: 69 YL 70 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,349,458 Number of Sequences: 237096 Number of extensions: 2176767 Number of successful extensions: 3675 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3668 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9311505506 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -