BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0109.Seq (926 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 5.2 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 5.2 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 5.2 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 5.2 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 5.2 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 5.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 5.2 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 6.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 6.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 6.9 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 9.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 9.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 9.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 9.1 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 5.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -3 Query: 735 RRFLERRLTDEYXRKRVSITRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 583 R+ + R D R+R ++ S ++ NY +N NN+ ++ NY Sbjct: 60 RKTSKERSRDRTERERSKEPKI--ISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 5.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -3 Query: 735 RRFLERRLTDEYXRKRVSITRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 583 R+ + R D R+R ++ S ++ NY +N NN+ ++ NY Sbjct: 60 RKTSKERSRDRTERERSKEPKI--ISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 5.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -3 Query: 735 RRFLERRLTDEYXRKRVSITRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 583 R+ + R D R+R ++ S ++ NY +N NN+ ++ NY Sbjct: 60 RKTSKERSRDRTERERSKEPKI--ISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 5.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -3 Query: 735 RRFLERRLTDEYXRKRVSITRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 583 R+ + R D R+R ++ S ++ NY +N NN+ ++ NY Sbjct: 60 RKTSKERSRDRTERERSKEPKI--ISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.6 bits (46), Expect = 5.2 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -3 Query: 735 RRFLERRLTDEYXRKRVSITRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 583 R+ + R D R+R ++ S ++ NY +N NN+ ++ NY Sbjct: 60 RKTSKERSRDRTERERSKEPKI--ISSLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 5.2 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 42 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 176 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 5.2 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +1 Query: 457 RHGR**RKITIRDSYEACNRNEYTLNI 537 +H R R T+ +SY+A + N +L++ Sbjct: 29 KHSRRHRDFTVAESYDASSSNSDSLSM 55 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 6.9 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +2 Query: 14 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 127 Y C + + LRR + ++++VP + +SYL Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 6.9 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = -3 Query: 720 RRLTDEYXRKRVSITRMRCTDSAAHKCNYELFNRNNFSIRYWSWNY 583 R + E R R R R + N + N NN+ Y + NY Sbjct: 293 RETSKERSRDRTERERSREPKIISSLSNKTIHNNNNYKYNYNNNNY 338 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 6.9 Identities = 19/80 (23%), Positives = 29/80 (36%) Frame = -2 Query: 502 RKSPVSLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 323 R S + TTS GSG V V + S N D+ L + + ++++ Sbjct: 222 RPSYTTATMATTSTPGSGSLPASPADSGVSDVESSTSSGGNEDANLLLKARLNPNSSLQP 281 Query: 322 **GRHLKDASPVLDHAICKS 263 H S L + C S Sbjct: 282 SLASHHSHLSSALGRSACHS 301 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 9.1 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 14 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 127 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 9.1 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +2 Query: 14 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 127 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 9.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 428 RQQARKLPTPGTGGSDE 478 R+Q RK TPG SDE Sbjct: 1768 RRQQRKQQTPGDVESDE 1784 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 9.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 428 RQQARKLPTPGTGGSDE 478 R+Q RK TPG SDE Sbjct: 1764 RRQQRKQQTPGDVESDE 1780 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 243,288 Number of Sequences: 438 Number of extensions: 5512 Number of successful extensions: 25 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30234750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -