BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ps4M0108.Seq
(782 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q8ID76 Cluster: Putative uncharacterized protein MAL13P... 36 1.5
>UniRef50_Q8ID76 Cluster: Putative uncharacterized protein
MAL13P1.317; n=1; Plasmodium falciparum 3D7|Rep: Putative
uncharacterized protein MAL13P1.317 - Plasmodium
falciparum (isolate 3D7)
Length = 1173
Score = 35.5 bits (78), Expect = 1.5
Identities = 20/57 (35%), Positives = 28/57 (49%)
Frame = +1
Query: 430 NSNKRVFFFPKLCIFILYICVYMMYLIKERRYISFRNAMP*TCKPNENRREYFYXNI 600
N +KR+ F + IFIL CV +Y I E Y + K NE +++Y Y I
Sbjct: 1043 NQHKRINRFVRNNIFILLNCVMDIYYIMEYTYPGRKKKKKKKVKLNEKKKKYIYITI 1099
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 601,450,820
Number of Sequences: 1657284
Number of extensions: 9784202
Number of successful extensions: 16039
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15663
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16031
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 66262109095
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -