BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0105.Seq (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal ... 23 4.6 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 6.0 >AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal carrier protein TOL-1 protein. Length = 272 Score = 23.0 bits (47), Expect = 4.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 68 SFTSRLVRLHYEISCMTLISPKNRAGHETK 157 S +LVRL + +S + L P A ETK Sbjct: 10 STVPQLVRLFWVVSLLALSLPAASASFETK 39 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 22.6 bits (46), Expect = 6.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 208 ETVGKTNVTKLISC 249 E VGK NVT +SC Sbjct: 594 ELVGKENVTTALSC 607 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,642 Number of Sequences: 2352 Number of extensions: 7364 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -