BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0105.Seq (423 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC127215-1|AAI27216.1| 92|Homo sapiens MED26 protein protein. 30 3.7 BC110430-1|AAI10431.1| 600|Homo sapiens mediator complex subuni... 30 3.7 AF104253-1|AAD12722.1| 600|Homo sapiens transcriptional co-acti... 30 3.7 >BC127215-1|AAI27216.1| 92|Homo sapiens MED26 protein protein. Length = 92 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = +1 Query: 148 RN*IACMKLMHALRKY*ITRETVGKTNVTKLIS 246 RN +A ++++ +L KY IT+E + +T + KLI+ Sbjct: 26 RNMVAVLEVISSLEKYPITKEALEETRLGKLIN 58 >BC110430-1|AAI10431.1| 600|Homo sapiens mediator complex subunit 26 protein. Length = 600 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = +1 Query: 148 RN*IACMKLMHALRKY*ITRETVGKTNVTKLIS 246 RN +A ++++ +L KY IT+E + +T + KLI+ Sbjct: 26 RNMVAVLEVISSLEKYPITKEALEETRLGKLIN 58 >AF104253-1|AAD12722.1| 600|Homo sapiens transcriptional co-activator CRSP70 protein. Length = 600 Score = 29.9 bits (64), Expect = 3.7 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = +1 Query: 148 RN*IACMKLMHALRKY*ITRETVGKTNVTKLIS 246 RN +A ++++ +L KY IT+E + +T + KLI+ Sbjct: 26 RNMVAVLEVISSLEKYPITKEALEETRLGKLIN 58 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,082,643 Number of Sequences: 237096 Number of extensions: 854982 Number of successful extensions: 1174 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3259265358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -