Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ps4M0104.Seq
         (961 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z73103-5|CAA97422.1|  380|Caenorhabditis elegans Hypothetical pr...    29   4.9  

>Z73103-5|CAA97422.1|  380|Caenorhabditis elegans Hypothetical
           protein C08F8.6 protein.
          Length = 380

 Score = 29.1 bits (62), Expect = 4.9
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = -2

Query: 393 GCPSREYYKIMYAFSKGQIYHQTRKE-LAYIMRNLIVSMRTVTDWFSFAGRQSPYTSRKF 217
           GCP REY  I+ A  KGQ + +   E + Y++R  +    T +  + +   QS     K 
Sbjct: 252 GCP-REYLDILEAIDKGQFFDEPNYERIYYLLREAM--KNTGSTEYPYDWEQSLMKKTKE 308

Query: 216 QDLKER*GAL 187
           +  K++ G +
Sbjct: 309 EQEKKKKGVV 318


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,671,465
Number of Sequences: 27780
Number of extensions: 386911
Number of successful extensions: 770
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 749
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 770
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2496624284
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)