BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0104.Seq (961 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 24 1.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 2.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 2.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 7.2 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 22 9.5 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 24.2 bits (50), Expect = 1.8 Identities = 11/43 (25%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 381 REYYK--IMYAFSKGQIYHQTRKELAYIMRNLIVSMRTVTDWF 259 +E+Y+ +++ F KG+ Q K+L + + + R +WF Sbjct: 5 KEHYRHILLFYFRKGKNASQAHKKLCAVYGDEALKERQCQNWF 47 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.8 bits (49), Expect = 2.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 102 CRSISLITLFGYYGYIFFTTDSSI 173 C S++ + GY YI+FTT +I Sbjct: 535 CGLSSMLCIPGYMIYIWFTTSGTI 558 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.8 bits (49), Expect = 2.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 102 CRSISLITLFGYYGYIFFTTDSSI 173 C S++ + GY YI+FTT +I Sbjct: 588 CGLSSMLCIPGYMIYIWFTTSGTI 611 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 7.2 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 Query: 652 HSRXGTSGPIESHHSHTT 705 H+ T GP HH H T Sbjct: 341 HTMGPTMGPPHHHHHHQT 358 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.8 bits (44), Expect = 9.5 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +2 Query: 176 HQFIRAPYLSLRSWNFRLVYGDCLPAKLNQSVTVLI 283 H +I + + + SW + + +PA++ VT L+ Sbjct: 219 HTYIPSALIVVMSWIAFWIKPEAIPARVTLGVTSLL 254 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 240,494 Number of Sequences: 438 Number of extensions: 5236 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31565079 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -