BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0103.Seq (960 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.02c |||non-specific DNA binding protein Spt2 |Schizosac... 29 0.97 SPAC17D4.02 |cdc45|sna41, goa1|DNA replication pre-initiation co... 26 6.9 >SPCC1393.02c |||non-specific DNA binding protein Spt2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 406 Score = 29.1 bits (62), Expect = 0.97 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +1 Query: 1 LVPNSARAGRESDKDFMQNNAKSSGGTVSDXNPRSPXPPQMFNDEE 138 L P RAGR S K+ G + + NPR P P F++ + Sbjct: 179 LPPAGLRAGRGSQISASLAWLKTGGASAAPSNPRQPPPTSNFSNRK 224 >SPAC17D4.02 |cdc45|sna41, goa1|DNA replication pre-initiation complex subunit Cdc45|Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 26.2 bits (55), Expect = 6.9 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 127 NDEEYCGDYDQFDLANEVDTLEQFLKL 207 N E YD +D ++VD+LE+ LKL Sbjct: 455 NQEWLHNFYDAYDALDDVDSLERALKL 481 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,623,518 Number of Sequences: 5004 Number of extensions: 40291 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 491307756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -