BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0101.Seq (870 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 4.1 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 9.5 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 9.5 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 22.6 bits (46), Expect = 4.1 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -3 Query: 469 RRCKTTASEL*YDSL*GELGTGPPLEKMGESLSTIC*STFAWISRWWIN 323 R ASE+ + L P E+ E L+ C T + +S W+ N Sbjct: 235 RNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN 283 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 142 LFYCNNVLKQNISVII 95 LFYC +KQ+I +I Sbjct: 19 LFYCYKTIKQHIYSLI 34 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 142 LFYCNNVLKQNISVII 95 LFYC +KQ+I +I Sbjct: 19 LFYCYKTIKQHIYSLI 34 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,359 Number of Sequences: 336 Number of extensions: 3207 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23996456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -