BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0101.Seq (870 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 5.2 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 24 6.9 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 6.9 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.2 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.2 bits (50), Expect = 5.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 157 FRKTNLFYCNNVLKQNISVIII 92 FRK + CNNV K IS+I I Sbjct: 718 FRKHVEYACNNVFKAAISLIQI 739 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.8 bits (49), Expect = 6.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 326 KLSPIFSSAKSRRYLQALLDTAFHII 249 KL+P F+S + R L LLD +I Sbjct: 128 KLTPTFTSGQLRNMLPTLLDVGNKLI 153 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.8 bits (49), Expect = 6.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 326 KLSPIFSSAKSRRYLQALLDTAFHII 249 KL+P F+S + R L LLD +I Sbjct: 128 KLTPTFTSGQLRNMLPTLLDVGNKLI 153 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 9.2 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +2 Query: 482 PWRYPT*SPAAHPPFASWRNSEEARNRSPFPTVAQLNGEWQIVSVNI 622 P YP + F RN EARNR+ +LNG Q +S + Sbjct: 203 PRCYPMPPEHMYNMFNFNRNGREARNRAEKNRRDKLNGSIQELSAMV 249 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 772,660 Number of Sequences: 2352 Number of extensions: 14814 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93026475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -