BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0099.Seq (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 22 6.4 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 22 6.4 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 6.4 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 6.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 6.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 6.4 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 202 NTICLDIEKTTPNTYKECGSFLEMFKKMQE 291 N + D+E P Y EC L+ F + E Sbjct: 48 NEVNFDVEDEKPQRYNEC--ILKQFNIVDE 75 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 202 NTICLDIEKTTPNTYKECGSFLEMFKKMQE 291 N + D+E P Y EC L+ F + E Sbjct: 48 NEVNFDVEDEKPQRYNEC--ILKQFNIVDE 75 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 54 REYRKYRETS-KERSRDR 70 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 467 QEVKKYRETSCEEEARSR 520 +E +KYRETS +E +R R Sbjct: 276 REYRKYRETS-KERSRDR 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,247 Number of Sequences: 438 Number of extensions: 3343 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -